SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000000965 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000000965
Domain Number 1 Region: 273-424
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.12e-41
Family Dual specificity phosphatase-like 0.00025
Further Details:      
 
Domain Number 2 Region: 227-275
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.00000902
Family DEK C-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000000965   Gene: ENSGGOG00000000979   Transcript: ENSGGOT00000000986
Sequence length 1027
Comment pep:novel chromosome:gorGor3.1:12:108280658:108348406:-1 gene:ENSGGOG00000000979 transcript:ENSGGOT00000000986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEAGSEEDRKLNLSLSESFFMVKGAALFLQQGSSPQGQRSLQHPHKHAGDLPQHLQVMIN
LLRCEDRIKLAVRLESAWADRVRYMVVVYSSGRQDTEENILLGVDFSSKESKSCTIGMVL
RLWSDTKIHLDGDGGFSVSTAGRMHIFKPVSVQAMWSALQVLHKACEVARRHNYFPGGVA
LIWATYYESCISSEQSCINEWNAMQDLESTRPDSPALFVDKPTEGERTERLIKAKLRSIM
MSQDLENVTSKEIRNELEKQMNCNLKEFKEFIDNEMLLILGQMDKPSLIFDHLYLGSEWN
ASNLEELQGSGVDYILNVTREIDNFFPGLFAYHNIRVYDEETTDLLAHWNEAYHFINKAK
RNHSKCLVHCKMGVSRSASTVIAYAMKEFGWPLEKAYNYVKQKRSITRPNAGFMRQLSEY
EGILDASKQRHNKLWRQQTDSSLQQPVDDPAGPGDFLPETPDGTPENRLPFLDDAAQPGL
GPPLPCCFRRLSDPLLPSPEDETGSLVHLEDPEREALLEEAAPPAEVHRLARQPQQGSGL
CEKDVKKKLEFGSPKGRSGSLLQVEETEREEGLGAGRWGQLPTQLDQNLLNSENLNNNNS
KRSCPDGMEHDAIFGILNKVKPSYKSCADCMYPTASGAPEASRERCEDPSAPAICTQPAF
LPHITSSPVAHLASRSRVPEKPASGPTEPPLFLPPAGSRRADTSGPGAGAALEPPASLLE
PSRETPKVLPKSLLLKNSHCDKNPPSTEVVIKEESSPKKDMKPAKDLRLLFSNESEKPTT
NSYLMQHQESIIQLQKAGLVRKHTKELERLKSVPADPAPPSRDGPAGRLEASIPEESQDL
AALHELGPLVMPSQAGSDEKSEAAPASLEGGSLKSPPPFLYRLDHTSSFSKDFLKTICYT
PTSSSMSSNLTRSSSSDSIHSVRGKPGLVKQRTQEIETRLRLAGLTVSSPLKRSHSLAKL
GSLNFSTEDLSSEADPSTVADSQDTTLSESSFLHEPQATPRDPAATSKPSGKPAPENLKS
PSWMSKS
Download sequence
Identical sequences ENSGGOP00000000965 ENSGGOP00000000965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]