SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001106 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001106
Domain Number 1 Region: 170-281
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 4.3e-52
Family Neurotrophin 0.000000812
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001106   Gene: ENSGGOG00000001122   Transcript: ENSGGOT00000001130
Sequence length 286
Comment pep:novel chromosome:gorGor3.1:1:118355544:118420381:-1 gene:ENSGGOG00000001122 transcript:ENSGGOT00000001130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLASGRAVQGAGWHAGPKLSSASGPNNSFTKGAAFYPGHTEVHSVMSMLFYTLITAFLIG
IQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPR
LFKKRRLRSPRVLFSTQPPPEAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSV
CDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSK
HWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Download sequence
Identical sequences ENSGGOP00000001106 ENSGGOP00000001106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]