SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001134 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001134
Domain Number 1 Region: 322-664
Classification Level Classification E-value
Superfamily DNase I-like 1.44e-76
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.00000162
Further Details:      
 
Domain Number 2 Region: 781-797,826-991
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.12e-35
Family BCR-homology GTPase activation domain (BH-domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001134   Gene: ENSGGOG00000001150   Transcript: ENSGGOT00000001158
Sequence length 993
Comment pep:novel chromosome:gorGor3.1:1:39132907:39220915:-1 gene:ENSGGOG00000001150 transcript:ENSGGOT00000001158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQSVAIQETLAEREYCVIAVQGVLCEGDSRQSRLLGLVRYHLEHGGQEHALFLYTHRRM
AITGDDVSLDQIVPVSRDFTLEEVSPDGELYILGSDVTVQLDTGELSLVFQLPFGSQTRM
FLHEVARACPGFDSATRDPEFLWLSRYRCAELELEMPTPRGCNSALVTWPGYTTIGGGRY
PSRKERWGLEEARPQGAGSVLFGGGAMEKTGFRLMERAHGGGFVWGRSARDGRRDEELEE
AGREMSAAAGSRERNTAGGSNFDGLRPNGKGVPMDQSSRGQDKPESLQPRQNKSKSEIID
MVRSSTITVSDKAHILSMQKFGLRDTIVKSHLLQKEEDYTYIQNFRFFVGTYNVNGQSPK
ECLRLWLSNGIQAPDVYCVGFQELDLSKEAFFFHDTPKEEEWFKAVSEGLHPDVKYAKVK
LIRLVGIMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSH
LAAHIEEYERRNQDYKDICSRMQFCQPDPSLPPLTISNHDVILWLGDLNYRIEELDVEKV
KKLIEEKDFQVLYAYDQLKIQVAAKTVFEGFTEGELTFQPTYKYDTGSDDWDTSEKCRAP
AWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVRVVNDELYRKTLEEIVRSLD
KMENANIPSVSLSKREFCFQNVKYMQLKVESFTIHNGQVPCHFEFINKPDEESYCKQWLN
ANPSRGFLLPDSDVEIELELFVNKTTATKLNSGEDKIEDILVLHLDRGKDYFLSVSGNYL
PSCFGSPIHTLCYMREPILDLPLETISELTLMPVWTGDDGSQLESPMEIPKELWMMVDYL
YRNAVQQEDLFQQPGLRSEFEHIRDCLDTGMIDNLSASNHSVAEALLLFLESLPEPVICY
STYHNCLECSGNYTASKQVISTLPIFHKNVFHYLMAFLRELLKNSAKNHLDENILASIFG
SLLLRNPAGHQKLDMTEKKKAQEFIHQFLCNTL
Download sequence
Identical sequences A0A2I2ZWZ6
XP_018871231.1.27298 ENSGGOP00000001134 ENSGGOP00000001134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]