SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001173 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001173
Domain Number 1 Region: 254-413
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.26e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000079
Further Details:      
 
Domain Number 2 Region: 40-149
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-25
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 
Domain Number 3 Region: 153-250
Classification Level Classification E-value
Superfamily LCCL domain 1.96e-20
Family LCCL domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001173   Gene: ENSGGOG00000001188   Transcript: ENSGGOT00000001197
Sequence length 714
Comment pep:novel chromosome:gorGor3.1:6:117825118:117868790:1 gene:ENSGGOG00000001188 transcript:ENSGGOT00000001197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPGARGGGALARAAGPGLLALLLAVSAPLRLQAEELGDGCGHLVTYQDSGTMTSKNYPG
TYPNHTVCEKTITVPKGKRLILRLGDLDIESQTCASDYLLFTSSSDQYGPYCGSMTVPKE
LLLNTSEVTVRFESGSHISGRGFLLTYASSDHPDLITCLERASHYLKTEYSKFCPAGCRD
VLLYILHNDVAVFQTSLLCKAAIHAGIIADELGGQISVLQRKGISRYEGILANGVLSRDG
SLSDKRFLFTSNGCSRSLSLEPDGQIRASSSWQSVNESGDQVHWSPGQARLQDQGPSWAS
GDSSNNHKPREWLEIDLGEKKKITGIRTTGSTQSNFNFYVKSFVMNFKNNNSKWKTYKGI
VNNEEKVFQGNSNFRDPVQNNFIPPIVARYVRVVPQTWHQRIALKVELIGCQITQGNDSL
VWRKTSQSTSVSTKKEDETITRPIPSEETSTGINITTVAIPLVLLVVLVFAGMGIFAAFR
KKKKKGSPYGSAEAQKTDCWKQIKYPFARHQSAEFTISYDNEKEMTQKLDLITSDMADYQ
QPLMIGTGTVTRKGSTFRPMDTDAEEAGVSTDAGGHYDCPQRADRHEYALPLAPPEPEYA
TPIVERHLLRAHTFSAQSGYRVPGPQPGHKHSLSSGGFSPVAGVGAQDGDYQRPHSAQPA
DRGYDRPKAVSAFATESGHSDSQKPPTHPGTSDSYSAPRDCLTPLNQTAVTALL
Download sequence
Identical sequences ENSGGOP00000001173 ENSGGOP00000020073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]