SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001182 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001182
Domain Number 1 Region: 9-406
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.14e-115
Family Motor proteins 0.00000124
Further Details:      
 
Domain Number 2 Region: 1311-1626
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.03e-55
Family WD40-repeat 0.00016
Further Details:      
 
Domain Number 3 Region: 974-1096
Classification Level Classification E-value
Superfamily Prefoldin 0.0000000000471
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001182   Gene: ENSGGOG00000001197   Transcript: ENSGGOT00000001206
Sequence length 1645
Comment pep:novel chromosome:gorGor3.1:1:180886721:180918361:-1 gene:ENSGGOG00000001197 transcript:ENSGGOT00000001206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQGDCCVKVAVRIRPQLSKEKIEGCHICTSVTPGEPQVLLGKDKAFTYDFVFDLDTWQ
EQIYSTCVSKLIEGCFEGYNATVLAYGQTGAGKTYTMGTGFDMATSEEEQGIIPRAIAHL
FGGIAERKRRAQEQGMAGPEFKVSAQFLELYNEEILDLFDSTRDPDTRHRRSNIKIHEDA
NGGIYTTGVTSRLIHSQEELIQCLKQGALSRTTASTQMNVQSSRSHAIFTIHLCQMRMCT
QPDLVNEAVTGLPDGTPPSSEYETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGL
LALGNVISALGDQSKKVVHVPYRDSKLTRLLQDSLGGNSPSQTIMIACVSPSDRDFMETL
NTLKYANRARNIKNKVVVNQDKTSQQISALRAEIARLQMELMEYKAGKRVIGEDGAEGYS
DLFRENAMLQKENGALRLRVKAMQEAIDAINNRVTQLMSQEANLLLAKAGDGNEAIGALI
QNYIREIEELRTKLLESEAMNESLRRSLSRASARSPYSLGASPAAPAFGGSPASSMEDAS
EVIRRAKQDLERLKKKEVRQRRKSPEKEAFKKRAKLQQENSEETDENEAEEEEEERDESG
CEEEEGREDEDEDSGSEESLVDSDSDPEEKEVNFQADLADLTCEIEIKQKLIDELENSQR
RLQTLKHQYEEKLILLQNKIRDTQLERDRVLQNLSTMECYTEEKANKIKADYEKRLREMN
RDLQKLQAAQKEHARLLKNQSRYERELKKLQAEVAEMKKAKVALMKQMREEQQRRRLVET
KRNREIAQLKKEQRRQEFQIRALESQKRQQEMVLRRKTQEVSALRRLAKPMSERVAGRAG
LKPPMLDSGAEVSASTTSSEAESGARSVSSIVRQWNRKINHFLGDHPAPTVNGTRPARKK
FQKKGASQSFSKAARLKWQSLERRIIDIVMQRMTIVNLEADMERLIKKREELFLLQEALR
RKRERLQAESPEEEKGLQELAEEIEVLAANIDYINDSITDCQATIVQLEETKEELDSTDT
SVVISSCSLAEARLLLDNFLKASIDKGLQVAQKEAQIRLLEGRLRQTDMAGSSQNHLLLD
ALREKAEAHPELQALIYNVQQENGYASTDEEISEFSEGSFSQSFTMKGSTSHDDFKFKSE
PKLSAQMKAVSAECLGPPLDISTKNITKSLASLVEIKEDGVGFSVRDPYYRDRVSRTVSL
PTRGSTTGLFCCSPRQSRATETSPLTRRKSYDRGQPIRSTDVGFTPPSSPPTRPRNDRNV
FSRLTSNQSQGSALDKSDDSDSSLSEVLRGIISPVGGAKGARTAPLQCVSMAEGHTKPIL
CLDATDELLFTGSKDRSCKMWNLVTGQEIAALKGHPNNVVSIKYCSHSGLVFSVSTSYIK
VWDIRDSAKCIRTLTSSGQVISGDACAATSTRAITSAQGEHQINQIALSSSGTMLYAASG
NAVRIWELSRFQPVGKLTGHIGPVMCLTVTQTASQHDLVVTGSKDHYVKMFELGECVTGT
IGPTHNFEPPHYDGIECLAIQGDILFSGSRDNGIKKWDLDQQELIQQIPNAHKDWVCALA
FIPGRPMLLSACRAGVIKVWNVDNFTPIGEIKGHDSPINAICTNAKHIFTASSDCRVKLW
NYVPGLTPCLPRRVLAIKGRATTLP
Download sequence
Identical sequences ENSGGOP00000001182 ENSGGOP00000023666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]