SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001254 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001254
Domain Number 1 Region: 882-1015
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-19
Family cAMP-binding domain 0.013
Further Details:      
 
Domain Number 2 Region: 624-738
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000029
Family Voltage-gated potassium channels 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001254   Gene: ENSGGOG00000001265   Transcript: ENSGGOT00000001278
Sequence length 1195
Comment pep:novel chromosome:gorGor3.1:3:111430952:111584752:-1 gene:ENSGGOG00000001265 transcript:ENSGGOT00000001278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIVSNINLHKNFSETWLEYLSTEDLPEVILTLSLISSIGAFLNRHLEDFPIPVPVILFL
LGCSFEVLSFTSSQVQRYANAIQWMSPDLFFRIFTPVIFFTTAFDMDTYMLQKLFWQILL
ITIPGFLVNYILVLWYLASVNQLLLKPTQWLLFSAILVSSDPMLTAAAIRDLGLSRSLIS
LINGESLMTSVISLITFTSIMDFDQRLQSKRNHTLAEEIVGGICSYIIASFLFGILSSKL
IQFWMSTVFGDDVNHISLIFSILYLIFYICELVGMSGIFTLAIVGLLLNSTSFKAAIEET
LLLEFWTFLSRIAFLMVFTFFGLLIPAHTYLYIEFVDIYYSLNTYFTLIVLRFLTLLLMS
PVLSRVGHEFSWRWVFIMVCSEMKGMPNINMALLLAYSDLYFGSDKEKSQILFHGVLVCL
ITLVVNRFILPVAVTILGLRDATSTKYKSVCCTFQHFQELTKSAASALKFDKDLANADWN
MIEKAIILENPYMLNEEETTEHQKVKCPHCNKEIDDIFNTEAMELANRRLLSAQIASYQR
QYRNEILSQSAVQVLVGAAESFGEKKGKCMSLDTIKNYSESQKTVTFARKLLLNWVYNTR
KEKEGPSKYFFFRICHTIVFTEEFEHVGYLVILMNIFPFIISWISQLNVIYHSELKHTNY
CFLTLYILEALLKIAAMRKDFFSHAWNIFELAITLIGILHVILIEIDNIKYIFNETEVIV
FIKVVQFIRILRIFKLIAPKLLQIIDKRMSHQKTFWYGILKGYVQGEADIMTVIDQITSS
KQIKQMLLKQVIRNMEHAIKELGYLEYDHPEIAVTVKTKEEINVMLNMATEILKAFSLKG
IISKTEGAGINKLIMAKKKEVLDSQXXXXDSQSIIRPLTVEEVLYHIPWLDKNKDYINFI
QEKAKVVTFDCGNDIFEEGEEPKGIYIIISGMVKLEKSKPGLGIDQMVESKEKDFPIIDT
DYMLSGEIIGEINCLTNEPMKYSATCKTVVETCFIPKTHLYDAFEQCSPLIKHKMWLKIG
LAITARKIREHLSYEDCNYKMQLKLSNIYVVDIPMSTKTDIYDENLIYVILIHGAVEDCL
LRKTYRAPFLIPITCHQIQSIEDFTKVVIIQTPINMKTFRRNIRKFVPKHKSSLTPGLIG
SAGTLEEGTQEETNVKEDGAHSAVTARSPRPCSLLETKFNCKESPRINLRKVRKE
Download sequence
Identical sequences ENSGGOP00000001254 ENSGGOP00000001254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]