SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001271 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001271
Domain Number 1 Region: 30-149,341-649
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.35e-66
Family Integrin alpha N-terminal domain 0.0000494
Further Details:      
 
Domain Number 2 Region: 169-364
Classification Level Classification E-value
Superfamily vWA-like 3.67e-52
Family Integrin A (or I) domain 0.00000000672
Further Details:      
 
Domain Number 3 Region: 934-1135
Classification Level Classification E-value
Superfamily Integrin domains 8.89e-41
Family Integrin domains 0.0023
Further Details:      
 
Domain Number 4 Region: 792-929
Classification Level Classification E-value
Superfamily Integrin domains 6.8e-25
Family Integrin domains 0.0036
Further Details:      
 
Domain Number 5 Region: 653-791
Classification Level Classification E-value
Superfamily Integrin domains 4.34e-17
Family Integrin domains 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001271   Gene: ENSGGOG00000001285   Transcript: ENSGGOT00000001296
Sequence length 1181
Comment pep:novel chromosome:gorGor3.1:17:44153655:44257892:-1 gene:ENSGGOG00000001285 transcript:ENSGGOT00000001296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPERTGAAPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKG
NWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLTLT
RNMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASFSPAAQPCPSLIDVVVVCD
ESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATS
QTSQYGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCN
HDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQ
IFSIEGTVQGGDNFQMEMSQVGFSADYSSQNDILMLGAVGAFGWSGTIVQKTSHGHLIFP
KQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNITVIQ
AHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMNDLKKEEGRVYLFTIKKGILGQH
QFLEGPDGIENTRFGSAIAALSDINMDGFNDVIVGSPLENQNSGAIYIYNGHQGTIRTKY
SQKILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADVAIEAS
FTPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKEN
NERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETAKV
FSIPFHKDCGEDGLCISDLVLDVQQIPAAQEQPFIVSNQNKRLTFSVTLKNKRESAYNTG
IVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQ
NLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSI
VHSFEDVGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDQAGDISCN
ADINPLKIGQTSSSVSFKRENFRHTKELNCRTASCSNVTCWLKDIHMKGEYFVNVTTRIW
NRTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPTGVIIGSII
AGILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELSS
Download sequence
Identical sequences ENSGGOP00000001271 ENSGGOP00000001271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]