SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001298 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000001298
Domain Number - Region: 48-97
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0433
Family Gelsolin-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001298   Gene: ENSGGOG00000001315   Transcript: ENSGGOT00000001323
Sequence length 318
Comment pep:novel chromosome:gorGor3.1:14:87604588:87606323:1 gene:ENSGGOG00000001315 transcript:ENSGGOT00000001323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLPPPDRRHVCLTTLVIMGSMAVMDAYLVEQNQGPRKIGVCIIVLVGDVCFLLVLRYVA
VWVGAEVRTAKRGYAMILWFLYIFVLEIKLYFIFQNYKAARRGAADPVARKALTLLLSVC
VPGLFLLLVALDRMEYVRTFRKREDLRGRLFWVALDLLDLLDMQASLWEPPRSGLPLWAE
GLTFFYCYMLLLVLPCVALSEVSMQGEHIAPQKMMLYPVLSLATVNVVAVLARAANMALF
RDSRVSAIFVGKNVVALATKACTFLEYRRQVRDFPPPALALELQPPPPQRNSVPPPPPLH
GPPGRPHMSSPTRDPLDT
Download sequence
Identical sequences A0A2I3TLT2 G3QG46
ENSGGOP00000001298 ENSGGOP00000001298 XP_004055855.1.27298 XP_016782364.1.37143 XP_016782365.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]