SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001333 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001333
Domain Number 1 Region: 164-365
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.87e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000892
Further Details:      
 
Domain Number 2 Region: 33-146,183-208
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-31
Family Pleckstrin-homology domain (PH domain) 0.0002
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000001333
Domain Number - Region: 614-698
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000523
Family BAR domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001333   Gene: ENSGGOG00000001347   Transcript: ENSGGOT00000001358
Sequence length 714
Comment pep:novel chromosome:gorGor3.1:10:60219988:60379765:-1 gene:ENSGGOG00000001347 transcript:ENSGGOT00000001358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPKIRQARRARSKSLVMGEQSRSPGRTPCPHRLGPVLKAGWLKKQRSIMKNWQQRWFV
LRGDQLFYYKDKDEIKPQGFISLQGTQVTELPPGPEDPGKHLFEISPGGAGEREKVPANP
EALLLMASSQRDMEDWVQAIRRVIWAPLGGGTARRSHAHPLEPLPPGIFGQRLEETVHHE
RKYGPRLAPLLVEQCVDFIRERGLTEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTDV
HTVASLLKLYLRELPEPVVPFARYEDFLSCAQLLTKDEGEGTLELAKQVSNLPQANYNLL
RYICKFLDEVQAYSNVNKMSVQNLATVFGPNILRPQVEDPVTIMEGTSLVQHLMTVLIRK
HSQLFTAPVPEGPTSPRGGLQCAVGWGSEEVTRDSQGEPGGPGLPAHRTSSLDGAAVAVL
SRTAPTGPGSRCSPGKKVQTLPSWKSSFRQPRSLSGSPKGGGSSLEVPIISSGGNWLMNG
LSSLRGHRRASSGDRLKDSGSVQRLSTYDNVPAPGLVPGIPSVASMAWSGASSSESSVGG
SLSSCTACRASDSSARSSLHTDWALEPSPLPSSSEDPKSLDLDHSMDEAGAGASNSEPSE
PDSPTREHARRSEALQGLVTELRAELCRQRTEYERSVKRIEEGSADLRNRMSRLEEELDQ
EKKKYIMLEIKLRNSERAREDAERRNQLLQREMEEFFSTLGSLTVGAKGARAPK
Download sequence
Identical sequences G3QG80
ENSGGOP00000001333 ENSGGOP00000001333 XP_004049428.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]