SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001368 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001368
Domain Number 1 Region: 20-226
Classification Level Classification E-value
Superfamily L domain-like 4.86e-38
Family Ngr ectodomain-like 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001368   Gene: ENSGGOG00000001384   Transcript: ENSGGOT00000001393
Sequence length 345
Comment pep:novel chromosome:gorGor3.1:3:56415725:56425404:-1 gene:ENSGGOG00000001384 transcript:ENSGGOT00000001393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGELLLFSSVIVLLQVVCSCPDKCYCQSSTNFVDCSQQGLAEIPSHLPPQTRTLHLQDN
QIHHLPAFAFRSVPWLMTLNLSNNSLSNLAPGAFHGLQHLQVLNLTQNSLLSLESRLFHS
LPQLRELDLSSNNISHLPTSLGETWENLTILAVQQNQLQQLDRALLESMPSVRLLFLKDN
LWKCNCHLLGLKLWLEKFVYKGGITDGIICESPDTWKGKDLLRIPHEVYQPCPLPAPDPV
SSQAQWPGSAHGVVLRPPENHNAGERDLLECELKPKPRPANLRHAIATIIITGVVCGIVC
LMMLAAAIYGCTYAAITAQYHGGPLAQTNDPGKVEEKERFDSSPA
Download sequence
Identical sequences G3QGB5
ENSGGOP00000001368 XP_004034381.1.27298 ENSGGOP00000001368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]