SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001401 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001401
Domain Number 1 Region: 6-144
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.04e-40
Family Gelsolin-like 0.00000671
Further Details:      
 
Domain Number 2 Region: 385-521
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.31e-38
Family Gelsolin-like 0.0000547
Further Details:      
 
Domain Number 3 Region: 241-433
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.12e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.011
Further Details:      
 
Domain Number 4 Region: 587-720
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 3.47e-33
Family Gelsolin-like 0.0000345
Further Details:      
 
Domain Number 5 Region: 507-608
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.37e-24
Family Gelsolin-like 0.00038
Further Details:      
 
Domain Number 6 Region: 120-230
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.1e-22
Family C-terminal, gelsolin-like domain of Sec23/24 0.014
Further Details:      
 
Domain Number 7 Region: 751-819
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 1.57e-21
Family VHP, Villin headpiece domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001401   Gene: ENSGGOG00000001418   Transcript: ENSGGOT00000001427
Sequence length 819
Comment pep:novel chromosome:gorGor3.1:12:55972105:55990108:-1 gene:ENSGGOG00000001418 transcript:ENSGGOT00000001427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLTSAFRAVDNDPGIIVWRIEKMELALVPVSAHGNFYEGDCYVILSTRRVASLLSQDIH
FWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQHREVQYHESDTFRGYFKQGIIYKQGGVA
SGMKHVETNTYDVKRLLHVKGKRNIRATEVEMSWDSFNRGDVFLLDLGKVIIQWNGPESN
NGERLKAMLLAKDIRDRERGGRAEIGVIEGDKEAASPELMKVLQDTLGRRSMIKPAVPDE
IIDQKQKSTIMLYHISDSAGQLAVTEVATRPLVQDLLNHDDCYILDQSGTKIYVWKGKGA
TKAEKQAAMSKALGFIKMKSYPSSTNVETVNDGAESAMFKQLFQKWSVKDQTMGLGKTFS
IGKIAKVFQDKFDVTLLHTKPEVAAQERMVDDGNGKVEVWRIENLELVPVEYQWYGFFYG
GDCYLVLYTYEVNGKPHHILYIWQGRHASQDELAASAYQAVEVDRQFDGAAVQVRVRMGT
EPRHFMAIFKGKLVIFEGGTSRKGNAEPDPPVRLFQIHGNDKSNTKAVEVPAFASSLNSN
DVFLLRTQAEHYLWYGKGSSGDERAMAKELASLLCDGSENTVAEGQEPAEFWDLLGGKTP
YANDKRLQQEILDVQSRLFECSNKTGQFIVTEITDFTQDDLNPSDVMLLDTWDQVFLWIG
AEANATEKESALATAQQYLHTHPSGRDPDTPILIIKQGFEPPIFTGWFLAWDPNIWSAGK
TYEQLKEELGDAAAIMRITADMKNATLSLNSNDSEPKYYPIAVLLKNQNQELPEDVNPAK
KENHLSEQDFVSVFGITRGQFAALPGWKQLQMKKEKGLF
Download sequence
Identical sequences ENSGGOP00000001401 ENSGGOP00000001401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]