SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001427 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001427
Domain Number 1 Region: 12-164
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.19e-23
Family G proteins 0.00086
Further Details:      
 
Domain Number 2 Region: 141-231
Classification Level Classification E-value
Superfamily Translation proteins 1.48e-22
Family Elongation factors 0.00078
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000001427
Domain Number - Region: 235-289
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.059
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001427   Gene: ENSGGOG00000001445   Transcript: ENSGGOT00000001454
Sequence length 521
Comment pep:novel chromosome:gorGor3.1:3:128007207:128299610:1 gene:ENSGGOG00000001445 transcript:ENSGGOT00000001454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAEPEPGEPLLQVTLVDCPGHASLIRTIIGGAQIIDLMMLVIDVTKGMQTQSAECLVIGQ
IACQKLVVVLNKIDLLAEGKRQAAIDKMTKKMQKTLENTKFRGAPIIPVAAKPGGPEAPE
TEAPQGIPELIELLTSQISIPTRDPSGPFLMSVDHCFSIKGQGTVMTGTILSGSISLGDS
VEIPALKVVKKVKSMQMFHMPITSAMQGDRLGICVTQFDPKLLERGLVCAPESLHTVHAA
LISVEKIPYFRGPLQTKAKFHITVGHETVMGRLMFFSPAPDNFDQEPILDSFDFSQEYLF
QEQYLSKDLTPAVTDNDKADKKAGQATEGHCPRQQWALVEFEKPVTCPRLCLVIGSRLDA
DIHTNTCRLAFHGILLHGLEDRNYADSFLPRLKVYKLKHKHGLVERAMDDYSVIGRSLFK
KETNIQLFVGLKVHLSTGELGIIDSAFGQSGKFKIHVPGGLSPESKKILTPALKKRARAG
RGEATRQEESAERSEPSQHVALSLTFKRYVFDTHKRMVQSP
Download sequence
Identical sequences ENSGGOP00000001427 ENSGGOP00000001427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]