SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001480 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001480
Domain Number 1 Region: 39-129
Classification Level Classification E-value
Superfamily Prefoldin 0.0000000000000523
Family Prefoldin 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001480   Gene: ENSGGOG00000001498   Transcript: ENSGGOT00000001508
Sequence length 130
Comment pep:novel chromosome:gorGor3.1:X:48439195:48440973:-1 gene:ENSGGOG00000001498 transcript:ENSGGOT00000001508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFPLPTPQEPIMATPPKRRAVEATGEKVLRYETFISDVLQRDLRKVLDHRDKVYEQLAK
YLQLRNVIERLQEAKHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALK
FIDRKSSLLT
Download sequence
Identical sequences ENSPTRP00000037520 ENSGGOP00000001480 9598.ENSPTRP00000037520 ENSPTRP00000037520 ENSGGOP00000001480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]