SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001611 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001611
Domain Number 1 Region: 7-399
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.69e-115
Family Motor proteins 0.00000144
Further Details:      
 
Domain Number 2 Region: 1328-1651
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.94e-59
Family WD40-repeat 0.00012
Further Details:      
 
Domain Number 3 Region: 978-1093
Classification Level Classification E-value
Superfamily Prefoldin 0.000000000133
Family Prefoldin 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000001611
Domain Number - Region: 425-546,598-639
Classification Level Classification E-value
Superfamily ARM repeat 0.00184
Family Armadillo repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001611   Gene: ENSGGOG00000001632   Transcript: ENSGGOT00000001646
Sequence length 1668
Comment pep:novel chromosome:gorGor3.1:12:36994869:37078577:-1 gene:ENSGGOG00000001632 transcript:ENSGGOT00000001646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFLIISHRIRPQLAKEKIEGCHICTSVTPGEPQVFLGKDKAFTFDYVFDIDSQQEQIYIQ
CIEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNIVEEELGIISRAVKHLFKSIEE
KKHIAVKNGLPAPDFKVNAQFLELYNEEVLDLFDTTRDIDAKSKKSNIRIHEDSTGGIYT
VGVTTRTVNTESEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHVCQTRVCPQIDADN
ATDNKIISESAQMNEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCGLLALGNV
ISALGDKSKRATHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLNTLKYANR
ARNIKNKVMVNQDRASQQINALRSEITRLQMELMEYKTGKRIIDEEGVESINDMFHENAM
LQTENNNLRVRIKAMQETVDALRSRITQLVSDQANHVLARAGEGNEEISNMIHSYIKEIE
DLRAKLLESEAVNENLRKNLTRATARAPYFSGSSTFSPTILSSDKETIEIIDLAKKDLEK
LKRKEKRKKKRLQKLEESNREERSVAGKEDNTDTDQEKKEEKGVSERENNELEVEESQEV
SDHEDEEEEEEEEEDDIDGGESSDESDSESDEKANYQADLANITCEIAIKQKLIDELENS
QKRLQTLKKQYEEKLMMLQHKIRDTQLERDQVLQNLGSVESYSEEKAKKVRSEYEKKLQA
MNKELQRLQAAQKEHARLLKNQSQYEKQLKKLQQDVMEMKKTKVRLMKQMKEEQEKARLT
ESRRNREIAQLKKDQRKRDHQLRLLEAQKRNQEVVLRRKTEEVTALRRQVRPMSDKVAGK
VTRKLSSSDAPAQDTGSSAAAVETDASRTGAQQKMRIPVARVQALPMPATNGNRKKYQRK
GLTGRVFISKTARMKWQLLERRVTDIIMQKMTISNMEADMNRLLKQREELTKRREKLSKR
REKIVKENGEGDKNVANINEEMESLTANIDYINDSISDCQANIMQMEEAKEEGETLDVTA
VINACTLTEARYLLDHFLSMGINKGLQAAQKEAQIKVLEGRLKQTEITSATQNQLLFHML
KEKAELNPELDALLGHALQDLDSVPLENVEDSTDEDAPLNSPGSEGSTLSSDLMKLCGEV
KPKNKARRRTTTQMELLYADSSELASDTSTGDASLPGPLTPVAEGQEIGMNTETSGTSAR
EKELSPPPGLPSKIGSISRQSSLSEKKIPEPSPVTRRKAYEKAEKSKAKEQKHSDSGTSE
ASLSPPSSPPSRPRNELNVFNRLTVSQGNTSVQQDKSDESDSSLSEVHSFPHLRGIINPF
PASKGIRAFPLQCIHIAEGHTKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQEIMSLGGH
PNNVVSVKYCNYTSLVFTVSTSYIKVWDIRDSAKCVRTLTSSGQVTLGDACSASTSRTVA
IPSGENQINQIALNPTGTFLYAASGNAVRMWDLKRFQSTGKLTGHLGPVMCLTVDQISNG
QDLIITGSKDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALTIQGDNLFSGSRDNGIK
KWDLTQKDLLQQVPNAHKDWVCALGVVPDHPVLLSGCRGGILKVWNMDTFMPVGEMKGHD
SPINAICVNSTHIFTAADDRTVRIWKARNLQDGQISDTGDLGEDIASN
Download sequence
Identical sequences ENSGGOP00000019352 ENSGGOP00000001611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]