SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001674 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001674
Domain Number 1 Region: 63-265
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.08e-57
Family G proteins 0.00012
Further Details:      
 
Domain Number 2 Region: 229-344
Classification Level Classification E-value
Superfamily Translation proteins 1.23e-25
Family Elongation factors 0.0098
Further Details:      
 
Domain Number 3 Region: 470-564
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 6.71e-22
Family EF-G/eEF-2 domains III and V 0.016
Further Details:      
 
Domain Number 4 Region: 354-433
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.45e-17
Family EF-G/eEF-2 domains III and V 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001674   Gene: ENSGGOG00000001699   Transcript: ENSGGOT00000001711
Sequence length 669
Comment pep:novel chromosome:gorGor3.1:4:45118703:45139257:1 gene:ENSGGOG00000001699 transcript:ENSGGOT00000001711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTLVGRGWGCARALPPRATGAALLVAPGPRPAPTLGAAPESWATDRLYSSAEFKEKLDM
SRFPVENIRNFSIVAHVDHGKSTLADRLLELTGTIDKTKNNKQVLDKLQVERERGITVKA
QTASLFYNCEGKQYLLNLIDTPGHVDFSYEVSRSLSACQGVLLVVDANEGIQAQTVANFF
LAFEAQLSVIPVINKIDLKNADPERVENQIEKVFDIPSDECIKISAKLGTNVESVLQAII
ERIPPPKVHRKNPLRALVFDSTFDQYRGVIANVALFDGVVSKGDKIVSAHTQKTYEVNEV
GVLNPNEQPTHKLYAGQVGYLIAGMKDVTEAQIGDTLCLHKQPMEPLPGFKSAKPMVFAG
MYPLDQSEYNNLKSAIEKLTLNDSSVTVHRDSSLALGAGWRLGFLGLLHMEVFNQRLEQE
YNASVILTTPTVPYKAVLSSSKLIKEHREKEITIINPAQFPDKSKVTEYLEPVVLGTIIT
PDEYTGKIMMLCEARRAVQKNMIFIDQNRVMLKYLFPLNEIVVDFYDSLKSLSSGYASFD
YEDAGYQTAELVKMDILLNGNTVEELVTVVHKDKAHSIGKAICERLKDSLPRQLFEIAIQ
AAIGSKIIARETVKAYRKNVLAKCYGGDITRKMKLLKRQAEGKKKLRKIGNVEVPKDAFI
KVLKTQSSK
Download sequence
Identical sequences G3SBM5
ENSGGOP00000001674 ENSGGOP00000025501 XP_004038674.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]