SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001697 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001697
Domain Number 1 Region: 622-920
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.49e-57
Family G proteins 0.00000861
Further Details:      
 
Domain Number 2 Region: 1088-1218
Classification Level Classification E-value
Superfamily Translation proteins 2.16e-33
Family Elongation factors 0.0012
Further Details:      
 
Domain Number 3 Region: 964-1084
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 1.57e-32
Family Initiation factor IF2/eIF5b, domain 3 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001697   Gene: ENSGGOG00000001721   Transcript: ENSGGOT00000001735
Sequence length 1220
Comment pep:novel chromosome:gorGor3.1:2a:96747260:96808000:1 gene:ENSGGOG00000001721 transcript:ENSGGOT00000001735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKQKNKSEDSTKDDIDLDALAAEIEGAGAAKEQEPQKSKGKKKKEKKKQDFDEDDILK
ELEELSLEAQGIKADRETVAVKPTENNEEEFTSKDKKKKGQKGKKQSFDDNDSEELEDKD
SKSKKTAKPKVEMYSGSDDDDDFNKLPKKAKGKAQKSNKKWDGSEEDEDNSKKIKERSRV
NSSGESGDESDEFLQSRKGQKKNQKNKPGPNIESGNEDDDASFKIKTVAQKKAEKKERER
KKRDEEKAKLRKLKEKEELETGKKDQSKQKESQRKSEEETVKSKVTVDTGVIPASEEKAE
TPTAAEDDNEADKKKKDKKKKKGEKEEKEKEKKKGPSKATVKAMQEALAKLKEEEERQKR
EEEERIKRLEELEAKRKEEERLEQEKRERKKQKEKERKERLKKEGKLLTKSQREARARAE
ATLKLLQAQGVEVPSKDSLPKKRPIYEDKKRKKIPQQLESKEVSESMELCAAVEVMEQGV
PEKEETPPPVEPEEEEDTEDAGLDDWEAMASDEETEKVEGNTVHIEVKENPEEEEEEEEE
EEEDEESEEEEEEEGESEGSEGDEEDEKVSDERDSGKTLDKKPSKEMSSDSEYDSDDDRT
KEERAYDKAKRRIEKRRLEHSKNVNTEKLRAPIICVLGHVDTGKTKILDKLRHTHVQDGE
AGGITQQIGATNVPLEAINEQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLC
DIAILVVDIMHGLEPQTIESINLLKSKKCPFIVALNKIDRLYDWKKSPDSDVAATLKKQK
KNTKDEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVE
LTQTMLSKRLAHCEELRAQVMEVKALPGMGTTIDVILINGRLKEGDTIIVPGVEGPIVTQ
IRGLLLPPPMKELRVKNQYEKHKEVEAAQGVKILGKDLEKTLAGLPLLVAYKEDEIPVLK
DELIHELKQTLNAIKLEEKGVYVQASTLGSLEALLEFLKTSEVPYAGINIGPVHKKDVMK
ASVMLEHDPQYAVILAFDVRIERDAQEMADSLGVRIFSAEIIYHLFDAFTKYRQDYKKQK
QEEFKHIAVFPCKIKILPQYIFNSRDPIVMGVTVEAGQVKQGTPMCVPSKNFVDIGIVTS
IEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRD
EMQKSDWQLIVELKKVFEII
Download sequence
Identical sequences A0A2I2Z5P7
ENSGGOP00000001697 ENSGGOP00000001697 XP_004031545.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]