SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001704 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001704
Domain Number 1 Region: 25-278
Classification Level Classification E-value
Superfamily L domain-like 1.76e-45
Family Ngr ectodomain-like 0.011
Further Details:      
 
Domain Number 2 Region: 312-576
Classification Level Classification E-value
Superfamily L domain-like 1.87e-41
Family Internalin LRR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001704   Gene: ENSGGOG00000001727   Transcript: ENSGGOT00000001742
Sequence length 662
Comment pep:novel chromosome:gorGor3.1:11:73661882:73675086:-1 gene:ENSGGOG00000001727 transcript:ENSGGOT00000001742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPQILLLLALLTLGLAAQHQDKVPCKMVDKKVSCQGLGLLQVPSVLPPDTETLDLSGNQ
LRSILASPLGFYTSLRHLDLSTNEISFLQPGAFQALTHLEHLSLAHNRLAMATALSAGGL
GPLPRVTSLDLSGNSLYSGLLERLLGEAPSLHTLSLSENSLTRLTRHTFRDMPALEQLDL
HSNVLMDIEDGAFEGLPRLTHLNLSRNSLTCISDFSLQQLRVLDLSCNSIEAFQTASQPQ
AEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLPTGPPQDSKGIHAPSEGWSAL
PLSTPSGNASARPLSQLLNLDLSYNEIELIPDSFLEHLTSLCFLNLSRNCLRTFEARRSG
SLPCLMLLDLSHNALETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQGN
RVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLRAGAFLHTPLTELDLSSNPGLE
VATGALGGLEASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEV
LDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLIC
RFSSQEEVSLSHVRPEDCEKGGLKNINLIIILTFILVSAILLTTLATCCCVRRQKFNQQY
KA
Download sequence
Identical sequences G3QH80
XP_004051895.1.27298 XP_004051896.1.27298 XP_018893098.1.27298 ENSGGOP00000001704 ENSGGOP00000001704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]