SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001842 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001842
Domain Number 1 Region: 12-225
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-47
Family DBL homology domain (DH-domain) 0.00021
Further Details:      
 
Domain Number 2 Region: 256-452
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.07e-37
Family BAR domain 0.0097
Further Details:      
 
Domain Number 3 Region: 592-672
Classification Level Classification E-value
Superfamily SH3-domain 1.14e-18
Family SH3-domain 0.00061
Further Details:      
 
Domain Number 4 Region: 494-568
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000459
Family SH3-domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001842   Gene: ENSGGOG00000001871   Transcript: ENSGGOT00000001883
Sequence length 675
Comment pep:novel chromosome:gorGor3.1:5:133415548:133471519:1 gene:ENSGGOG00000001871 transcript:ENSGGOT00000001883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKHGADEPSSRSGSPDGEGRASEDRSLLHQRLAVRELIDTEVSYLHMLQLCASDIRSRL
QQLPQGDLDVLFSNIDDIIKVNSRFLHDLQETASKEEEQVQLVGNIFLEFQEELEQVYKV
YCASYDQALLLVDTYRKEPELQRHIQGIVEMVVPQAGSSGLSFLLVIPLQRITRYPLLLQ
KILENTVPDASAYPVLRRAVSALQDVNTNINEYKMRKEVASKYTKVEQLTLRERLARINT
HTLSKKTTRLSQLLKQEAGLIPRTEDKEFDDLEERFQWVSLCVTELKNNVAAYLDNLQAF
LYFRPHEYNLDVPEGPAVQYCNLARDLHLEAFLKFKQRLEGLVWQPLCSLAKALLGPQNL
IKKRLDKLLDFERVEEKLLEVGSVTYQEEAARHTYQALNSLLVAELPQFNQLVMQWLGQI
LRTFVTLQRDLAKQVLQRAEGSMAQLPHHHVPEPAFRKLVEDALGQTSNQLRSFQETFEK
VLPPPTTQPLLPGSERQVQALLSRYGPGKLYQVTSNISGTGTLDLTLPRGQIVAILQNKD
TKGNSGRWLVDTGGHRGYVPAGKLQLYHVVPSAEELRRQAGLNKDPRCLTPEPSPAPVPS
IPTVNQVIAVYPFVARSSHEVSLQAGQPVTILEAQDKKGNPEWSLVEVNGQRGYVPSGFL
ARARSPVLWGWSLPS
Download sequence
Identical sequences ENSGGOP00000001842 ENSGGOP00000001842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]