SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001892 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001892
Domain Number 1 Region: 44-278
Classification Level Classification E-value
Superfamily L domain-like 3.12e-39
Family Leucine rich effector protein YopM 0.043
Further Details:      
 
Domain Number 2 Region: 601-711
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-25
Family Calponin-homology domain, CH-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001892   Gene: ENSGGOG00000001918   Transcript: ENSGGOT00000001933
Sequence length 721
Comment pep:novel chromosome:gorGor3.1:X:112541144:112665423:-1 gene:ENSGGOG00000001918 transcript:ENSGGOT00000001933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLVVPIPVPTLFGQPFPNGPPWNPGSLQPQHTVRSLDRALEEAGSSGILSLSGRKLRDFP
GSGYDLTDTTQADLSRNRFTEIPSDVWLFAPLETLNLYHNCIKTIPEAIKNLQMLTYLNI
SRNLLSTLPKYLFDLPLKVLVVSNNKLVSIPEEIGKLKDLMELDISCNEIQVLPQQMGKL
HSLRELNIRRNNLHVLPDELGDLPLVKLDFSCNKVTEIPVCYRKLHHLQVIILDNNPLQV
PPAQICLKGKVHIFKYLNIQACCRMDKKPDSLDLPSLSKRMPSQPLTDSMEDFYPNKNHG
PDSGIGSDNGEKRLSTTEPSDDDTVSLHSQVSESNREQISRNDSHIIGSKTDSQKDQEVY
DFVDPNTEDVAVPEQGNAHIGSFVSFFKGKEKCSEKSRKNEELEDEKRLEKEQLLAEEED
DDLKEVTDLRKIAAQLLQQEQKNRILNHSTSVMRNKPKQSVECEKSVSADEVNSPLSPLT
WQPLENQKDQIDEQPWPESHPIIWQSEERRRSKQIRKEYFKYKSMRKSSSGNENDEQDSD
NANMSPQSPVSSEEYDRTHGFSHSPFGLKPRSAFSRSSRQEYGAADPGFTMRRKMEHLRE
EREQIRQLRNNLESRLKVILPDDIGAALMDGVVLCHLANHIRPRSVASIHVPSPAVPKLS
MAKCRRNVENFLDACKKLGVSQERLCLPHHILEERGLVKVGVTVQALLELPTTKASQLSM
A
Download sequence
Identical sequences ENSGGOP00000001892 ENSGGOP00000001892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]