SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001912 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001912
Domain Number 1 Region: 5-90
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-23
Family PDZ domain 0.0000192
Further Details:      
 
Domain Number 2 Region: 319-348
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000207
Family LIM domain 0.00076
Further Details:      
 
Domain Number 3 Region: 288-318
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000166
Family LIM domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001912   Gene: ENSGGOG00000001942   Transcript: ENSGGOT00000001954
Sequence length 364
Comment pep:novel chromosome:gorGor3.1:4:196328122:196361894:-1 gene:ENSGGOG00000001942 transcript:ENSGGOT00000001954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESM
THADAQDRIKAAAHQLCLKIDRGETHLWSPQVSEDGKAHPFKINLESEPQDGNYFEHKHN
IRPKPFVIPGRSSGCSTPSGIDCGSGRSTPSSVSTVSTICPGDLKVAAKLAPNIPLEMEL
PGVKIVHAQFNTPMQLYSDDNIMETLQGQVSTALGETPLMSEPTASVPPESDVYRMLHDN
RNEPTQPRQSGSFRVLQGMVDDGSDDRPAGTRSVRAPVTKVHGGSGGAQRMPLCDKCGSG
IVGAVVKARDKYRHPECFVCADCNLNLKQKGYFFIEGELYCETHARARTKPPEGYDTVTL
YPKA
Download sequence
Identical sequences A0A2I2ZRV2 Q53GG5
ENSP00000284770 ENSP00000284770 ENSGGOP00000001912 ENSP00000284767 9606.ENSP00000284770 ENSGGOP00000001912 gi|166235176|ref|NP_055291.2| NP_055291.2.87134 NP_055291.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]