SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001938 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001938
Domain Number 1 Region: 74-359
Classification Level Classification E-value
Superfamily L domain-like 1.25e-56
Family Ngr ectodomain-like 0.000000138
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000001938
Domain Number - Region: 7-55
Classification Level Classification E-value
Superfamily ARM repeat 0.00964
Family Armadillo repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001938   Gene: ENSGGOG00000001968   Transcript: ENSGGOT00000001980
Sequence length 381
Comment pep:novel chromosome:gorGor3.1:9:74364954:74384040:-1 gene:ENSGGOG00000001968 transcript:ENSGGOT00000001980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEYVLLLFLALCSAKPFFSPSHTALKNMMLKDMEDTDDDDDDDDDDDDDDDEDNSLFPT
REPRSHFFPFDLFPMCPFGCQCYSRVVHCSDLGLTSVPTNIPFDTRMLDLQNNKIKEIKE
NDFKGLTSLYGLILNNNKLTKIHPKAFLTTKKLRRLYLSHNQLSEIPLNLPKSLAELRIH
ENKVKKIQKDTFKGMNALHVLEMSANPLDNNGIEPGAFEGVTVFHIRIAEAKLTSVPKGL
PPTLLELHLDYNKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENN
KLKKIPSGLPELKYLQIIFLHSNSIARVGVNDFCPTVPKMKKSLYSAISLFNNPVKYWEM
QPATFRCVLSRMSVQLGNFGM
Download sequence
Identical sequences G3SJH4
ENSGGOP00000028264 XP_004048312.1.27298 ENSGGOP00000001938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]