SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001948 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001948
Domain Number 1 Region: 581-794
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.0000559
Further Details:      
 
Domain Number 2 Region: 368-488
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-19
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 3 Region: 64-143
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000118
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 4 Region: 263-292
Classification Level Classification E-value
Superfamily WW domain 0.0000128
Family WW domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001948   Gene: ENSGGOG00000001977   Transcript: ENSGGOT00000001990
Sequence length 795
Comment pep:novel chromosome:gorGor3.1:12:55617729:55633626:-1 gene:ENSGGOG00000001977 transcript:ENSGGOT00000001990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESLTLCSGEAERRGNEEWPGKAEAEVWVLKGLQCPFFSQVTVLATMLSSRWWPSSWGILG
LGPRSPPRGSQLCALYAFTYTGADGQQVSLAEGDRFLLLRKTNSDWWLARRLEAPSTSRP
IFVPAAYMIEESIPSQSPTTVIPGQLLWTPGPKLFHGSLEELSQALPSRAQASSEQPPPL
PPKMCRSVSTDNLSPSLPKPFQEGPSGRSLSQEDLPSEASASTAGPQPLMSEPPVYCNLV
DLRRCPRSPPPGPACPLLQRLDAWEQHLDPNSGRCFYINSLTGCKSWKPPRRSRSETNPG
SMEGTQTLKRNNDVLQPQAKGFRSDTGTPEPLDPQGSLSLSQRTSQLDPPALQAPRPLPQ
LLDDPHEVEKSGLLNMTKIAQGGRKLRKNWGPSWVVLTGNSLVFYREPPPTAPSSGWGPA
GSRPESSVDLRGAALAHGRHLSSRRNVLHIRTVPGHEFLLQSDHETELRAWHRALRTVIE
RLVRWVEARREARAGRDQGSGXXXXXXXLRLSGSGPAELSAGEDEEEESEPVSKPLLRLS
SRRSSIRGPESTEQNRVRNKLKRLIAKRPPLQSLQERGLLRDQVFGCQLESLCQREGDTV
PSFVRLCIAAVDKRGLDVDGIYRVSGNLAVVQKLRFLVDRERAVTSDGRYVFPEQPGQEG
RLDLDSTEWDDIHVVTGALKLFLRELPQPLVPPLLLPHFRAALALSESEQCLSQIQELIG
SMPKPNHDTLRYLLEHLCRVIAHSDKNRMTPHNLGIVFGPTLFRPEQETSDPAAHALYPG
QLVQLMLTNFTSLFP
Download sequence
Identical sequences ENSGGOP00000026873 ENSGGOP00000001948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]