SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001966 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001966
Domain Number 1 Region: 23-113
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 2.15e-22
Family MHC antigen-recognition domain 0.0000483
Further Details:      
 
Domain Number 2 Region: 112-199
Classification Level Classification E-value
Superfamily Immunoglobulin 1.7e-20
Family C1 set domains (antibody constant domain-like) 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001966   Gene: ENSGGOG00000001997   Transcript: ENSGGOT00000002008
Sequence length 204
Comment pep:novel chromosome:gorGor3.1:7:97483459:97490200:1 gene:ENSGGOG00000001997 transcript:ENSGGOT00000002008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSVLLSLLLLLGPAVPQETRDGHYSLTYLYTGLSKPGKGTHRLQGTVFLNGRAFFHYNS
EDRKAEPLGPWRHVEGVEDWEKQSQVQNAREDIFMETLNNIMEYYNDSNGDPPCVVVTSH
QAPGEKKKLKCLAYDFYPGKTDVHWTRAGEVQEPELRGDVLHGGNGTYQTWLLVHVPPQD
TAPYSCHVQYSSLAQPLLVPGEAR
Download sequence
Identical sequences ENSGGOP00000001966 ENSGGOP00000018454 ENSGGOP00000001966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]