SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002049 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002049
Domain Number 1 Region: 24-121
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-35
Family Chaperone J-domain 0.00019
Further Details:      
 
Domain Number 2 Region: 252-330
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.02e-19
Family HSP40/DnaJ peptide-binding domain 0.00083
Further Details:      
 
Domain Number 3 Region: 130-153,194-254
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.00000000000000262
Family HSP40/DnaJ peptide-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002049   Gene: ENSGGOG00000002079   Transcript: ENSGGOT00000002093
Sequence length 359
Comment pep:novel chromosome:gorGor3.1:3:188018179:188033708:1 gene:ENSGGOG00000002079 transcript:ENSGGOT00000002093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMAPQNLSTFCLLLLYLIGAVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPD
DPQAQEKFQDLGAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGG
TPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQ
LGPGRFQMTQEVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPGDL
RFRIKVVKHPIFERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHISRDKITRPGAKL
WKKGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYNGLQGY
Download sequence
Identical sequences ENSGGOP00000002049 ENSGGOP00000002049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]