SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002150 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002150
Domain Number 1 Region: 253-405
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-32
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 143-251
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-23
Family Second domain of FERM 0.0015
Further Details:      
 
Domain Number 3 Region: 57-143
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.79e-21
Family First domain of FERM 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002150
Domain Number - Region: 491-554
Classification Level Classification E-value
Superfamily Prefoldin 0.0549
Family Prefoldin 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002150   Gene: ENSGGOG00000002181   Transcript: ENSGGOT00000002196
Sequence length 1034
Comment pep:novel chromosome:gorGor3.1:3:70619663:70982221:-1 gene:ENSGGOG00000002181 transcript:ENSGGOT00000002196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVFMCGVEDLLFSGSRFVWNLTVSTLRRWYTERLRACHQVLRTWCGLQDVYQMTEGRH
CQVHLLDDRRLELLVQPKLLARELLDLVASHFNLKEKEYFGITFIDDTGQQNWLQLDHRV
LDHDLPKKPGPTILHFAVRFYIESISFLKDKTTVELFFLNAKACVHKGQIEVDSETIFKL
AAFILQEAKGDYTSDENARKDLKTLPAFPTKTLQEHPSLPYCEDRVIEHYLKIKGLTRGQ
AVVQYMKIVEALPTYGVHYYAVKDKQGLPWWLGISYKGIGQYDIQDKVKPRKLFQWKQLE
NLYFREKKFAVEVHDPRRISVSRRTFGQSGLFVQTWYANSSLIKSIWVMAISQHQFYLDR
KQSKAKIPSARSLDEIAMDLTETGTQRASKLVTLEAKSQFIMASNGSLISSGSQDSEVSE
EQKREKILELKKKEKLLQEKLLKKVEELKKICLREAELTGKMPKEYPLNIGEKPPQVRRR
VGTAFKLDDNLLPSEEDPALQELESNFLIQQKLVEAAKKLANEPDLCKTVKKKRKQDYTD
AMKKLQEIENAINEYRIRCGKKPSQKATVLPEDIIPSESSSLSDTTTYDDPSDAFTLPGQ
RSSSVPHSPRILPPKSLGIERIHFRKSSINEQFVDTRQSREMLSTHSSPYKTLERRPQGG
RSMPTTPVLTRNAYSSSHLEPESSSQHCRQRSGSLESQSHLLSEMDSDKPFFSLSKSQRS
SSTEILDDGSSYTSQSSTEYYCVTPVTGPYYTTQTLDTRTRGRRRSKKQNASTSNSGSMP
NLAQKDSLRNGVYSKSQEPPSSSYYIAGYTPYAECDFYYSGGYVYENDTEGQYSVNPSYR
SSAHYGYERQRDYSRSFHEDEVDRVPHNPYATLRLPRKAAAKSEHITKNIHKALVAEHLR
GWYQRASGQKDQGHSPQTSFDSDRGSQRCLGFAGLQVPCSPSSRASSYSSVSSTNASGNW
RTQLTIGLSDYETPAHSSYTSCYGNVYNPLPSPSRQYTEISQLDGTDGNRLEDNLESSEQ
RLFWHEDSKPGTLV
Download sequence
Identical sequences G3QIE2
XP_004035922.1.27298 ENSGGOP00000002150 ENSGGOP00000002150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]