SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002159 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002159
Domain Number 1 Region: 26-145,327-613
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.83e-56
Family Integrin alpha N-terminal domain 0.0000765
Further Details:      
 
Domain Number 2 Region: 154-332
Classification Level Classification E-value
Superfamily vWA-like 2.07e-41
Family Integrin A (or I) domain 0.0000000158
Further Details:      
 
Domain Number 3 Region: 774-914
Classification Level Classification E-value
Superfamily Integrin domains 1.05e-23
Family Integrin domains 0.0039
Further Details:      
 
Domain Number 4 Region: 614-773
Classification Level Classification E-value
Superfamily Integrin domains 5.23e-22
Family Integrin domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002159   Gene: ENSGGOG00000002189   Transcript: ENSGGOT00000002205
Sequence length 1170
Comment pep:novel chromosome:gorGor3.1:16:31217957:31272678:1 gene:ENSGGOG00000002189 transcript:ENSGGOT00000002205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRPGRHFGYRVLQVGNGVIVGA
PGEGNSTGSLYQCQSGTGHCLPVTLRGSNYTSKYLGMTLATDPTDGSILACDPGLSRTCD
QNTYLSGLCYLFRQNLQGPMLQGRPGFQECIKGNVDLVFLFDGSMSLQPDEFQKILDFMK
DVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTNTFGAINYV
ATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLH
KFASKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELSSSGISADLSR
GHAVVGAVGAKDWAGGFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSREKTSLL
ASGAPRYQHVGRVLLFQEPQGGGHWSQVQTIHGTQIGSYFGGELCGVDVDQDGETELLLI
GAPLFYGEQRGGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAITALTDINGDGLVDVA
VGAPLEEQGAVYIFNGRHGGLSPQPSQRIEGTQVLSGIQWFGRSIHGVKDLEGDGLADVA
VGAESQMIVLSSRPVVDVVTLMSFSPAEIPVHEVECSYSTSNKMKEGVNITICFQIKSLI
PQFQGRLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNIAVTTSMSCTDFSFHFPVCVQD
LISPINVSLNFSLREEEGTPRDQRAQGKDIPPILRPSLHSETWEIPFEKNCGEDKKCEAN
LRVSFSPARSRALRLTAFASLSVELSLSNLEEDAYWVQLDLHFPRGLSFRKVEMLKPHSQ
IPVSCEELPEESRLLSRALSCNVSSPIFKAGHLVALQMMFNTLVNSSWGDSVELHANVTC
NNEDSGLLEDNSATTIIPILYPINILIQDQENSTLYVSFTPKGPKIHQVKHMYQVRIQPS
IHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFR
CPVVFRQEILVQVIGTLELVGEIEASSMFSLCSSLSISFNSSKHFHLYGSNASLAQVVMK
VDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAVRGVPNGIPAEDS
EQLASGQEAGDPGCLKPLHEKDSESGGGKD
Download sequence
Identical sequences G3QIF0
ENSGGOP00000002159 ENSGGOP00000002159 XP_018868338.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]