SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002268 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002268
Domain Number 1 Region: 1480-1635
Classification Level Classification E-value
Superfamily FAS1 domain 6.15e-29
Family FAS1 domain 0.0014
Further Details:      
 
Domain Number 2 Region: 886-1037
Classification Level Classification E-value
Superfamily FAS1 domain 3.14e-28
Family FAS1 domain 0.0016
Further Details:      
 
Domain Number 3 Region: 523-655
Classification Level Classification E-value
Superfamily FAS1 domain 2.35e-24
Family FAS1 domain 0.0018
Further Details:      
 
Domain Number 4 Region: 1650-1790
Classification Level Classification E-value
Superfamily FAS1 domain 3.27e-23
Family FAS1 domain 0.0034
Further Details:      
 
Domain Number 5 Region: 1052-1173
Classification Level Classification E-value
Superfamily FAS1 domain 6.02e-22
Family FAS1 domain 0.0046
Further Details:      
 
Domain Number 6 Region: 381-504
Classification Level Classification E-value
Superfamily FAS1 domain 7.32e-19
Family FAS1 domain 0.0013
Further Details:      
 
Domain Number 7 Region: 2049-2101,2157-2266
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000000000111
Family FAS1 domain 0.0081
Further Details:      
 
Domain Number 8 Region: 2096-2150
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000461
Family Link domain 0.0099
Further Details:      
 
Domain Number 9 Region: 1382-1421
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000172
Family EGF-type module 0.072
Further Details:      
 
Domain Number 10 Region: 1424-1462
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000754
Family Merozoite surface protein 1 (MSP-1) 0.086
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002268
Domain Number - Region: 1994-2030
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 235-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000433
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 325-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000837
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 785-825
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family EGF-like domain of nidogen-1 0.058
Further Details:      
 
Domain Number - Region: 1345-1378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00352
Family EGF-like domain of nidogen-1 0.087
Further Details:      
 
Domain Number - Region: 736-780
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00488
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 1908-2030
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00502
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 198-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.01
Family Merozoite surface protein 1 (MSP-1) 0.035
Further Details:      
 
Domain Number - Region: 819-873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0205
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 1867-1910
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002268   Gene: ENSGGOG00000002297   Transcript: ENSGGOT00000002318
Sequence length 2368
Comment pep:novel chromosome:gorGor3.1:12:102927273:103133662:1 gene:ENSGGOG00000002297 transcript:ENSGGOT00000002318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMLQHLVIFCLGFVVQNFCSPAETTGQARRCDRKSLLTIRTECRSCALNLGVKCPDGYTK
ITSGSVGVRDCRYTFEVRTYSLSLPGCRHICRKDYLQPQCCPGRWGPDCIECPGGAGSPC
NGRGSCAEGMEGNGTCSCQEGFGGTACETCADDNLFGPSCSSVCNCVHGVCNSGLDGDGT
CECYSAYTGPKCDKPIPECAALLCPENSRCSPSTEDENKLECKCLPNYRGDGKYCDPINP
CLRKICHPHAHCTYLGPNRHSCTCQEGYRGDGQVCLPVDPCQINFGNCPTKSTVCKYDGP
GQSHCECKEHYQNFVPGVGCSMTDICKSDNPCHRNANCTTVAPGRTECICQKGYVGDGLT
CYGNIMERLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSKLGPFTVLLPTDKGLKGFNV
NELLVDNKAAQYFVKLHIIAGQMNIEYMNNTDTFYTLTGKSGEIFNSDKDNQIKLKLYGG
KKKVKIIQGDIIASNGLLHILDRAMDKLEPTFESNNEQTIMTVLQPRYSKFRSLLEETNL
GHGLDEDGVGGPYTIFVPSNEALNNMKDGTLDYLLSPEGSRKLLELVRYHIVPFTQLEVA
TLISTPHIRSMANQLIQFNTTDNGQILANDVAMEEIEITAKNGRIYTLTGVLIPPSIVPI
LPHRCDETKREMKLGTCVSCSLVYWSRCPANSEPTALFTHTCVYSGRFGSLKSGCARYCN
ATVKIPKCCKGFYGPDCNQCPGGFSNPCSGNGQCADSLGGNGTCICEEGFQGSQCQFCSD
PNKYGPRCNKAECIKTGTGTHTCVCQQGWTGNGRDCLEINNCLLPSAGGCHDNATCLYVG
PGQNECECEKGFRGNGIDCEPITSCLEQTGKCHPLASCQSTSSGVWSCVCQEGYEGDGFL
CYGNAAVELSFLSEAAIFNRWINNASLQPTLSATSNLTVLVPSQQATEDMDQDEKSFWLS
QSNIPALIKYHMLLGTYRVADLQTLSSSDMLATSLQGNFLHLAKVDGNITIEGASIVDGD
NAATNGVIHIINKVLVPQRRLTGSLPNLLMRLEQMPDYSIFRGYIIQYNLANAIEAADAY
TVFAPNNNAIENYIREKKVLSLEEDVLRYHVVLEEKLLKNDLHNGMHRETMLGFSYFLSF
FLHNDQLYVNEAPINYTNIATDKGVIHGLGKVLEIQKNRCDNNDTTIIRGRCRTCFSELT
CPFGTKSLGNEKRRCIYTSYFMGRRTLFIGCQPKCVRTVITRECCAGFFGPQCQPCPGNA
QNVCFGNGICLDGVNGTGVCECGEGFSGTACETCTEGKYGIHCDQACSCVHGRCNQGRLG
DGSCDCDVGWRGVHCDNATTEDNCNGTCHTSANCLTNSDGTASCKCAAGFQGNGTICTAI
NACEISNGGCSAKADCKRTTPGRRVCTCKAGYTGDGIVCLEINPCLENHGGCDKNAECTQ
TGPNQAACNCLPAYTGDGKVCTFINVCLTKNGGCSEFAICNHTGQGERTCTCKPNYIGDG
FTCRGSIYQELPKNPKTSQYFFQLQEHFVKDLVGPGPFTVFAPLSAAFDEEARVKDWDKY
GLMPQVLRYHVVACHQLLLENLKLISNATSLQGEPIVISVSQSTVYINNKAKIISSDIIS
TNGIVHIIDKLLSPKNLLITPKDTSGRILQNLTTLATNNGYIKFSNLIQDSGLLSVITDP
IHTPVTLFWPTDQALHALPAEQQDFLFNQDNKDKLKEYLKFHVIRDAKVLAVDLPTSTAW
KTLQGSELSVKCGAGRDIGDLFLNGQTCRIVQRELLFDLGVAYGIDCLLIDPTLGGRCDT
FTTFDASGECGSCVNTPSCPRWSKPKGVKQKCLYNLPFKRNLEGCRERCSLVIQIPRCCK
GYFGRDCQACPGGPDAPCNNRGVCLDQYSATGECKCNTGFNGTACEMCWPGRFGPDCLPC
GCSDHGQCDDGITGSGQCLCETGWTGPSCDTQAVLPAVCTPPCSAHATCKENNTCECNLD
YEGDGITCTVVDFCKQDNGGCAKVARCSQKGTKVSCSCQKGYKGDGHSCTEIDPCADGLN
GGCHEHATCKMTGPGKHKCECKSHYVGDGLNCEPEQLPIDRCLQDNGQCHADAKCVDLHF
QDTTVGVFHLRSPLGQYKLTFDKAREACANEAATMATYNQLSYAQKEVLAYSNSSARGRA
FLEHLTDLSIRGTLFVPQNSGLGENETLSGRDIEHHLANVSMFFYNDLVNGTTLQTRLGS
KLLITASQDPLQPTETRFVDGRAILQWDIFASNGIIHVISRPLKAPPAPVTLTHTGLGAG
IFFAIILVTGAVALAAYSYFRINRRTIGFQHFESEEDINVAALGKQQPENISNPLYESTT
SAPPEPSYDPFTDSEEWQLEGNDPLGTL
Download sequence
Identical sequences ENSGGOP00000002268 ENSGGOP00000002268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]