SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002485 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002485
Domain Number 1 Region: 73-312
Classification Level Classification E-value
Superfamily L domain-like 1.21e-33
Family Internalin LRR domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002485   Gene: ENSGGOG00000002523   Transcript: ENSGGOT00000002538
Sequence length 343
Comment pep:novel chromosome:gorGor3.1:12:7104473:7114079:1 gene:ENSGGOG00000002523 transcript:ENSGGOT00000002538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDEDDLEDSEPDQDDSEKEEDEKETEEGEDYRKEGEEFPEEWLPTPLTEDMMKEGLSLL
CKTGNGLAHAYVKLEVKERDLTDIYLLRSYIHLRYVDISENHLTDLSPLNYLTHLLWLKA
DGNRLRSAQLNELPYLQIASFAYNQITDTEGISHPRLETLNLKGNSIHTVTGLDPEKLIS
LHTVELRGNQLESTLGINLPKLKNLYLAQNMLKKVEGLEDLSNLTTLHLRDNQIDTLSGF
SREMKSLQYLNLRGNMVANLGELAKLRDLPKLRALVLLDNPCTDETSYRQEALVQMPYLE
RLDKEFYEEEERAEADEIRQRLKEEKEQEPEPERDLEPEQSLI
Download sequence
Identical sequences G3QJ98
XP_004052650.1.27298 XP_004052651.1.27298 ENSGGOP00000002485 ENSGGOP00000002485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]