SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002526 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002526
Domain Number 1 Region: 232-332,364-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-75
Family Protein kinases, catalytic subunit 0.000000000403
Further Details:      
 
Domain Number 2 Region: 122-265
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-39
Family SH2 domain 0.00000114
Further Details:      
 
Domain Number 3 Region: 51-172
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-23
Family SH3-domain 0.0000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002526   Gene: ENSGGOG00000002562   Transcript: ENSGGOT00000002579
Sequence length 539
Comment pep:novel chromosome:gorGor3.1:1:33342436:33375474:1 gene:ENSGGOG00000002562 transcript:ENSGGOT00000002579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENDTLLDSQLEEKGLGASPWDNLGQQLLLLPTGSLVDFLKT
PSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIE
DNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVI
QNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQPQP
Download sequence
Identical sequences ENSGGOP00000002526 ENSGGOP00000002526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]