SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002673 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002673
Domain Number 1 Region: 333-411
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 7.15e-25
Family Intermediate filament protein, coiled coil region 0.0000214
Further Details:      
 
Domain Number 2 Region: 106-142
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000000173
Family Intermediate filament protein, coiled coil region 0.00055
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002673
Domain Number - Region: 225-329
Classification Level Classification E-value
Superfamily Prefoldin 0.00217
Family Prefoldin 0.0095
Further Details:      
 
Domain Number - Region: 155-246
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0034
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002673   Gene: ENSGGOG00000002710   Transcript: ENSGGOT00000002727
Sequence length 470
Comment pep:novel chromosome:gorGor3.1:2b:108384487:108396600:1 gene:ENSGGOG00000002710 transcript:ENSGGOT00000002727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTS
GGAGGLGSLRASRLGTTRAPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFA
NYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVER
DNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLK
KVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKV
SDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEA
SGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPI
QTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
Download sequence
Identical sequences ENSGGOP00000002673 ENSGGOP00000002673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]