SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002761 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002761
Domain Number 1 Region: 434-511
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.44e-24
Family Intermediate filament protein, coiled coil region 0.00035
Further Details:      
 
Domain Number 2 Region: 202-236
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000235
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 241-312
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000282
Family Intermediate filament protein, coiled coil region 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002761
Domain Number - Region: 340-435
Classification Level Classification E-value
Superfamily Prefoldin 0.00012
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002761   Gene: ENSGGOG00000002805   Transcript: ENSGGOT00000002819
Sequence length 605
Comment pep:novel chromosome:gorGor3.1:12:50441701:50452021:-1 gene:ENSGGOG00000002805 transcript:ENSGGOT00000002819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRECHQKALSTSSAPPPQDAHKSHETRALQPPVFSTACTSPSQVPSHRPSSPTMSRQSS
ITFQSGSRRGFSTTSAITPAAGRSRFSSVSVARSAAGSGGLGRISSAGASFGSRSLYNLG
GAKRVSISGCGSSFRSGFGGRASNGFGVNSGFGYGGGVGGGFSGPSFPVCPPGGIQEVTV
NQSLLTPLHLQIDPAIQRVRAEEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQE
QGSRTVRQNLEPLFDSYISELRRQLESVTTERGRLEAELRNMQDVVEDFKVRYEDEINKR
TAAENEFVALKKDVDAAYMNKVELEAKVKSLPEEINFIHSVFDAELSQLQTQVSDTSVVL
SMDNNRNLDLDSIIAEVKAQYEDIANRSRAEAESWYQTKYEELQVTAGRHGDDLRNTKQE
ISEMNRMIQRLRAEIDSIKKQCSSLQTAIADAEQRGELALKDARAKLVDLEEALQKAKQD
MARLLREYQELMNIKLALDVEIATYRKLLEGEECRLSGEGVSPVNISVVTSTLSSGYGRG
SSIGGGNLGLGGGRGYSFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVSTTSSSQ
KSYTH
Download sequence
Identical sequences ENSGGOP00000002761 ENSGGOP00000002761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]