SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002770 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002770
Domain Number 1 Region: 399-476
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.31e-24
Family Intermediate filament protein, coiled coil region 0.00036
Further Details:      
 
Domain Number 2 Region: 167-201
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000445
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 206-277
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000012
Family Intermediate filament protein, coiled coil region 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002770
Domain Number - Region: 309-400
Classification Level Classification E-value
Superfamily Prefoldin 0.00157
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002770   Gene: ENSGGOG00000003126   Transcript: ENSGGOT00000002828
Sequence length 590
Comment pep:novel chromosome:gorGor3.1:12:50531094:50536457:-1 gene:ENSGGOG00000003126 transcript:ENSGGOT00000002828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQSSVSFRSGGSRSFSTASAITPSVSRTSFTSVSRSGGGGGGGFGRVSLGGACGVGGY
GSRSLYNLGGSKRISISTSGGSFRNRFAAGAGGGYGFGGGAGSGFGFGGGAGGGFGLGGG
AGFGGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPSIQRVRTEEREQIKTLNNKFA
SFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRL
DSELRNMQDLVEDFKNKYEDEINKRTTAENEFVMLKKDVDAAYMNKVELEAKVDALMDEI
NFMKMFFDAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESW
YQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQR
GELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECR
LSGEGVGPVNISVVTSSVSSGYGSGSGYGGGLSGGLGGGLGGSLAGGGSGSYYSSSSGGV
GLGGGLSVGGSGFSASSGRGLGVGFGSGGGSSSSVKFVSTTSSSRKSFKS
Download sequence
Identical sequences G3QKU2
XP_004053218.1.27298 ENSGGOP00000003077 ENSGGOP00000002770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]