SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002771 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002771
Domain Number 1 Region: 811-1028
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.12e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 676-796
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000267
Family PLC-like (P variant) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002771   Gene: ENSGGOG00000002813   Transcript: ENSGGOT00000002829
Sequence length 1194
Comment pep:novel chromosome:gorGor3.1:1:87450948:87494342:-1 gene:ENSGGOG00000002813 transcript:ENSGGOT00000002829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHDLPPDSGARRGGGGLADHSFPAGARAPGQPPSRGAAYRRACPRDGERGGGGRPRQQVS
PPRSPQREPRGGQLRTPRMRPSCSRSLESLRVGAKPPPFQRWPSDSWIRCGAHGDWDEPP
PRGGRMDGWSGDRARAAAPTGLQPPGSKDHGCSSGSPFRDPAGSSVIRSGKGDRQEGPSF
LRPPAVTVKKLQKWMYKGRLLSLGMKGRARGTAPKVTGTQAASPNVGALKVRENRVLSVP
PDQRITLTDLFENAYGSSMKRRELEDLKDNIEFRGHKPLNSITVSKKRNWLYQSTLRPLN
LEEENKKCQDRSHLSISPVSLPKHQLSQSFLKSSKEYCTYVVCNATNSSLSKNCALDFNE
ENDADDEGEIWYNPIPEDDDLGISSALSFGEADSAVLKLPAVSLSMLSGSDLMKAEQHTE
DSLCSSEHSGDIQTTRSNGMNPIDPAHSTEFVQQYKQKLGHKTQEGIMVEDSPMLKSPFA
GSGILAATNSIELGIIEPSSPNPSPVKKGSSINWSLPDKIKSPRTVRKLSMKMKKLPEFS
RKLSVKGTLNYINSPDNTPSLSKYNCREIHHTDILPSGNTTTAAKRNVISRYHLDTSVSS
QQSYQKKNSMSSKYSCKGGYLSDGDSPELTTKASKHGSESKFGKGKEIISNSCSKNEIDI
DAFRHYSFSDQPKCSQYISGLMSVHFYGAEDLKPPRIDSKDVFCAIQVDSVNKARTALLT
CRTTFLDMDHTFNIEIENAQHLKLVVFSWEPTPRKNRVCCHGTVVLPTLFRVTKTHQLAV
KLEPRGLIYVKVTLMEQWENSLHGLDINQEPIIFGVDIQKVVEKENIGLMVPLLIQKCIM
EIEKRGCQVVGLYRLCGSAAVKKELREAFERDSKAVGLCENQYPDINVITGVLKDYLREL
PSPLITKQLYEAVLDAMAKSPLKMSSNGCENDPSDSKYTVDLLDCLPEIEKATLKMLLDH
LKLVASYHEVNKMTCQNLAVCFGPVLLSQRQEPSTYNNRVFTDSEELASALDFKKHIEVL
HYLLQLWPEQRLTVKKSTDNLFPEQKSSLNYLRQKKERPHMLNLSGTDSSGVLRPRQNRL
DSPLSNRYAGDWSSCGENYFLNTKENLNDVDYDDVPSEDREIGENYSKMDGPEVMIEQPI
PMSKECTFQTYLTMQTIESTVDRKNNLKDLQESIDTLIGNLERELNKNKLNMSF
Download sequence
Identical sequences ENSGGOP00000002771 ENSGGOP00000002771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]