SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002865 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002865
Domain Number 1 Region: 324-402
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.53e-25
Family Intermediate filament protein, coiled coil region 0.0000415
Further Details:      
 
Domain Number 2 Region: 92-128
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000134
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 3 Region: 99-206
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000186
Family Myosin rod fragments 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002865
Domain Number - Region: 214-322
Classification Level Classification E-value
Superfamily Prefoldin 0.0199
Family Prefoldin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002865   Gene: ENSGGOG00000002914   Transcript: ENSGGOT00000002929
Sequence length 499
Comment pep:novel chromosome:gorGor3.1:10:116864924:116878159:1 gene:ENSGGOG00000002914 transcript:ENSGGOT00000002929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSL
GLGLAYRRPPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNR
ALEAELAALRQRHAEPSRVGELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRA
RCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLA
TLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR
STEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAEVAGYQDSIGQ
LENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPL
PNPSYLLPPRILSSTTSKVSSTGLSLKKEEEEEEASKVASKKTSQIGESFEEILEETVIS
TKKTEKSNIEETTISSQKI
Download sequence
Identical sequences G3QK94 H2Q2I4
ENSGGOP00000002865 XP_001134873.1.37143 XP_003825585.1.60992 XP_004050083.1.27298 ENSGGOP00000002865 ENSPTRP00000005120 9598.ENSPTRP00000005120 ENSPTRP00000005120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]