SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003036 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003036
Domain Number 1 Region: 43-338
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.79e-96
Family G proteins 0.000000357
Further Details:      
 
Domain Number 2 Region: 540-660
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.84e-33
Family Translational machinery components 0.00013
Further Details:      
 
Domain Number 3 Region: 304-331,367-454
Classification Level Classification E-value
Superfamily Translation proteins 7.78e-26
Family Elongation factors 0.00073
Further Details:      
 
Domain Number 4 Region: 664-754
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.55e-24
Family EF-G/eEF-2 domains III and V 0.00061
Further Details:      
 
Domain Number 5 Region: 463-541
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.76e-23
Family EF-G/eEF-2 domains III and V 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003036   Gene: ENSGGOG00000003085   Transcript: ENSGGOT00000003104
Sequence length 770
Comment pep:novel chromosome:gorGor3.1:3:159382023:159431687:1 gene:ENSGGOG00000003085 transcript:ENSGGOT00000003104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLGAAAVAALGRGRAPASLGWQRKQVNWKACRWSSSGVIPNEKIRNIGISAHIDSGKT
TLTERVLYYTGRIAKMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWKDVNINIID
TPGHVDFTIEVERALRVLDGAVLVLCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRMG
SNPARALQQMRSKLNHNAAFMQIPIGLEGNFKGIIDLIEERAIYFDGDFGRFLRDFLPLL
WNWDRRSGSQIVRYGEIPAELRAAATDHRQELIECVANSDEQLGEMFLEEKIPSISDLKL
AIRRATLKRSFTPVFLGSALKNKGVQPLLDAVLEYLPNPSEVQNYAILNKEDDSKEKTKI
LMNSSRDNSHPFVGLAFKLEVGRFGQLTYVRSYQGELKKGDTIYNTRTRKKVRLQRLARM
HADMMEDVEEVYAGDICALFGIDCASGDTFTDKANSGLSMESIHVPDPVISIAMKPSNKN
DLEKFSKGIGRFTREDPTFKVYFDTENKETVISGMGELHLEIYAQRLEREYGCPCITGKP
KVAFRETITAPVPFDFTHKKQSGGAGQYGKVIGVLEPLDPEDYTKLEFSDETFGSNIPKQ
FVPAVEKGFLDACEKGPLSGHKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALANA
TLCILEPIMAVEVVAPNEFQGQVIAGINRRHGVITGQDGVEDYFTLYADVPLNDMFGYST
ELRSCTEGKGEYTMEYSRYQPCLPSTQEDVINKYLEATGQLPVKKGKAKN
Download sequence
Identical sequences G3S1S5
ENSGGOP00000022021 XP_018879806.1.27298 ENSGGOP00000003036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]