SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003080 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003080
Domain Number 1 Region: 361-437
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.67e-21
Family Intermediate filament protein, coiled coil region 0.00063
Further Details:      
 
Domain Number 2 Region: 129-163
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000277
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 3 Region: 170-239
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000251
Family Intermediate filament protein, coiled coil region 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003080   Gene: ENSGGOG00000003132   Transcript: ENSGGOT00000003148
Sequence length 523
Comment pep:novel chromosome:gorGor3.1:12:50560047:50569292:-1 gene:ENSGGOG00000003132 transcript:ENSGGOT00000003148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQFTCKSGAAAKGGFSGCSAVLSGGSSSSFRAGSKGLSGGFGSRSLYSLGGVRSLNVA
SGSGKSGGYGFGRGRASGFAGSMFGSVALGPVCPTVCPPGGIHQVTVNESLLAPLNVELD
PEIQKVRAQEREQIKALNNKFASFIDKVRFLEQQNQVLETKWELLQQLDLNNCKNNLEPI
LEGYISNLRKQLETLSGDRVRLDSELRNVRDVVEDYKKRYEEEINKRTAAENEFVLLKKD
VDAAYANKVELQAKVESMDQEIKFFRCLFEAEITQIQSHISDMSVILSMDNNRNLDLDSI
IDEVRTQYEEIALKSKAEAEALYQTKFQELQLAAGRHGDDLKNTKNEISELTRLIQRIRS
EIENVKKQASNLETAIADAEQRGDNALKDARAKLDELEGALHQAKEELARMLREYQELMS
LKLALDMEIATYRKLLESEECRMSGEFPSPVSISIISSTSGGSGYGFRPSTVSGGYVANS
SNCISGVCSVRGGEGRSRGSANDYKDTLGKGSSLSAPSKKTSR
Download sequence
Identical sequences G3QKU5
ENSGGOP00000003080 XP_004053219.1.27298 ENSGGOP00000003080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]