SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003082 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003082
Domain Number 1 Region: 337-415
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.53e-23
Family Intermediate filament protein, coiled coil region 0.00044
Further Details:      
 
Domain Number 2 Region: 139-173
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000251
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003082
Domain Number - Region: 157-215
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00105
Family Intermediate filament protein, coiled coil region 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003082   Gene: ENSGGOG00000003134   Transcript: ENSGGOT00000003150
Sequence length 496
Comment pep:novel chromosome:gorGor3.1:12:50583158:50589949:-1 gene:ENSGGOG00000003134 transcript:ENSGGOT00000003150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQLNIKSSGDKGNFSVHSAVVPRKAVGSLASYCAAGRGAGAGFGSRSLYSLGGNRRIS
FNVAGGGVRAGGYGFRPGSGYGGGRASGFAGSMFGSVALGPACLSVCPPGGIHQVTVNKS
LLAPLNVELDPEIQKVRAQEREQIKVLNDKFASFIDKVRFLEQQNQVLETKWELLQQRLD
SELRSMRDLVEDYKKRYEVEINRRTAAENEFVVLKKDADAAYAVKVELQAKVDSLDKDIK
FLKCLYDAEIAQIQTHASETSVILSMDNNRDLDLDSIIAEVRMHYEEIALKSKAEAEALY
QTKIQELQLAASRHGDDLKHTRSEMVELNRLIQRIRCEIGNVKKQRASLETAIADAEQRG
DNALKDARAKLDELEGALHQAKEELARMLREYQELMSLKLALDMEIATYRKLLEGEECRM
SGENPSSVSISVISSSSYSYHHPSSTGADLGASAVAGSSGSTQSGQTKTTEERGGDLKDS
QGKSTPASIPARKATR
Download sequence
Identical sequences ENSGGOP00000003082 ENSGGOP00000003082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]