SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003084 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003084
Domain Number 1 Region: 356-432
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 5.58e-22
Family Intermediate filament protein, coiled coil region 0.00067
Further Details:      
 
Domain Number 2 Region: 124-158
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000377
Family Intermediate filament protein, coiled coil region 0.0017
Further Details:      
 
Domain Number 3 Region: 165-235
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000732
Family Intermediate filament protein, coiled coil region 0.008
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003084
Domain Number - Region: 253-355
Classification Level Classification E-value
Superfamily Prefoldin 0.0162
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003084   Gene: ENSGGOG00000003136   Transcript: ENSGGOT00000003152
Sequence length 511
Comment pep:novel chromosome:gorGor3.1:12:50601420:50617264:-1 gene:ENSGGOG00000003136 transcript:ENSGGOT00000003152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQLTHFPRGERLGFSGYSAVLSGRIGSSSASFRAGVKGSASFGSKSLFCLGGSRRLAL
SAAAGRGGGRLGGFVGTVFGSAGLGPACPSVCPPGGIPQVTVNKSLLAPLSVELDPEIQR
VRAQEREQIKALNNKFASFIDKVRFLEQQNQVLETKWNLLQQLDLNNCRKNLEPIYEGYI
NNLQKQLEMLSGDRVRLDSELRNMQDLVEDYKKRYEVEINRRTAAENEFVVLKKDMDAAY
MNKVELQAKVDSLTDEIKFFKCLYEGEITQIQSHISDTSVVLSMDNNRDLDLDSIIAEVR
AQYEEIALKSKAEAETLYQTKIQELQVTAGQHGDDLKLTKAEISELNHLIQRIRSEIGNV
KKQCANLETAIADAEQRGHCALKDARAKLDELEGALHQAKEELARMLREYQELMSLKLAL
DMEIATYRKLLESEECRMSGEYPNSVSISVISSTNAGAGGAGFSMGFGASSSYSYKTAAA
DVKTKGSCGSELKDPLAKTLGSSCATKKASR
Download sequence
Identical sequences ENSGGOP00000003084 ENSGGOP00000003084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]