SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003091 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003091
Domain Number 1 Region: 153-238
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.92e-26
Family Thyroglobulin type-1 domain 0.00000461
Further Details:      
 
Domain Number 2 Region: 68-110
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000863
Family Growth factor receptor domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003091   Gene: ENSGGOG00000003143   Transcript: ENSGGOT00000003159
Sequence length 243
Comment pep:novel chromosome:gorGor3.1:12:51117442:51122175:1 gene:ENSGGOG00000003143 transcript:ENSGGOT00000003159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YTLSGLHSRPPLLPLLPTLQSLHGPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGC
AEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENP
KESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTE
VYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTG
SIG
Download sequence
Identical sequences ENSGGOP00000020776 ENSGGOP00000003091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]