SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003111 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003111
Domain Number 1 Region: 6-112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-22
Family Spermadhesin, CUB domain 0.0000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003111   Gene: ENSGGOG00000003166   Transcript: ENSGGOT00000003181
Sequence length 114
Comment pep:novel chromosome:gorGor3.1:10:136738321:136740612:1 gene:ENSGGOG00000003166 transcript:ENSGGOT00000003181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLVAPSDCGGHYTDEYGRIFNYVGPKTECVWIIELNPREIVTVAIPDLKLRGFACGKEY
VEVLDGPPGSESLGRICRAFSTFYYSSSNIITIKYSREPSHPPTFFEIYYFVDA
Download sequence
Identical sequences ENSGGOP00000003111 ENSGGOP00000003111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]