SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003200 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003200
Domain Number 1 Region: 166-292
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-32
Family Pleckstrin-homology domain (PH domain) 0.00051
Further Details:      
 
Domain Number 2 Region: 327-435
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-24
Family SH2 domain 0.0000339
Further Details:      
 
Domain Number 3 Region: 24-84
Classification Level Classification E-value
Superfamily Phenylalanine zipper 6.67e-22
Family Adapter protein APS, dimerisation domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003200   Gene: ENSGGOG00000003254   Transcript: ENSGGOT00000003273
Sequence length 551
Comment pep:novel chromosome:gorGor3.1:12:110956725:110988961:1 gene:ENSGGOG00000003254 transcript:ENSGGOT00000003273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGPALQPSSASSAPSASPAAAPRGWSEFCELHAVAAARELARQYWLFAREHPQHAPLRA
ELVSLQFTDLFQRYFCREVRDGRAPGRDYRDTGRGPPAKAEASPEPGPGPAAPGLPKARS
SEELAPPRPPGPCSFQHFRRSLRHIFRRRSAGELPTPARPGLAKKLLPWSLAREPPPEAL
KEAVLRYSLADEASMDSGARWQRGRLALRRAPGPDGPDRVLELFDPPKSSRPKLQAACSS
IQEVRRCTQLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMAELSECTGRGLESTEAE
MHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDPACQKTDHFLSCYPWFHGPISRVKAAQ
LVQLQGPDAHGVFLVRQSETRRGEYVLTFNFQGIAKHLRLSLTERGQCRVQHLHFPSVVD
MLHHFQRSPIPLECGAACDVRLSSYVVVVSQPPGSCNTVLFPFSLPHWDSELGLPHLSST
GCPRGLSPEGLPGRSSPPEQIFHLVPSPEELANSLRHLEHEPVNRARDSDYEMDSSSRSH
LRAIDNQYTPL
Download sequence
Identical sequences ENSGGOP00000003200 ENSGGOP00000003200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]