SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003326 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000003326
Domain Number - Region: 56-112
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0436
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003326   Gene: ENSGGOG00000003383   Transcript: ENSGGOT00000003401
Sequence length 197
Comment pep:novel chromosome:gorGor3.1:6:109441481:109457570:-1 gene:ENSGGOG00000003383 transcript:ENSGGOT00000003401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLSRSLLWAATCLGVLCVLSADNNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPET
CEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTA
NSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVI
FFLYKFCKSKERNYHTL
Download sequence
Identical sequences G3QLH3
ENSGGOP00000003326 ENSGGOP00000003326 XP_018884884.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]