SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003368 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003368
Domain Number 1 Region: 65-202
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-40
Family Dual specificity phosphatase-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003368   Gene: ENSGGOG00000003429   Transcript: ENSGGOT00000003445
Sequence length 217
Comment pep:novel chromosome:gorGor3.1:2b:71148936:71166280:1 gene:ENSGGOG00000003429 transcript:ENSGGOT00000003445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDL
SSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAHGVENAFLSDFTYKSISILDL
PETNILSYFPECFEFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLV
KNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS
Download sequence
Identical sequences A0A2I2YU44
ENSGGOP00000003368 XP_004032968.1.27298 ENSGGOP00000003368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]