SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003397 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003397
Domain Number 1 Region: 1299-1439
Classification Level Classification E-value
Superfamily PH domain-like 4.1e-54
Family Phosphotyrosine-binding domain (PTB) 0.00000175
Further Details:      
 
Domain Number 2 Region: 173-301
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.92e-39
Family PLC-like (P variant) 0.002
Further Details:      
 
Domain Number 3 Region: 7-170
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.31e-30
Family Dual specificity phosphatase-like 0.00021
Further Details:      
 
Domain Number 4 Region: 1165-1286
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-23
Family SH2 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003397   Gene: ENSGGOG00000003450   Transcript: ENSGGOT00000003474
Sequence length 1445
Comment pep:novel chromosome:gorGor3.1:7:48360197:48637646:-1 gene:ENSGGOG00000003450 transcript:ENSGGOT00000003474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGHGLDLTYITERIIAVSFPAGCSEESYLHNLQEVTRMLKSKHGDNYLVLNLSEKRYD
LTKLNPKIMDVGWPELHAPPLDKMCTICKAQESWLNSNPQHVVVIHCRGGKGRIGVVISS
YMHFTNVSASADQALDRFAMKKFYDDKVSALMQPSQKRYVQFLSGLLSGSVKMNASPLFL
HFVILHGTPNFDTGGVCRPFLKLYQAMQPVYTSGIYNVGPENPSRICIVIEPAQLLKGDV
MVKCYHKKYRSATRDVIFRLQFHTGAVQGYGLVFGKEDLDNASKDDRFPDYGKVELVFSA
TPEKIQGSEHLYNDHGVIVDYNTTDPLIRWDSYENLSADGEVLHTQGPVDGSLYAKVRKK
SSSDPGIPGGPQAIPPTNSPDHSDHTLSVSSDSGHSTASARTDKTEERLAPGTRRGLSAQ
EKAELDQLLSGFGLEDPGSSLKEMTDARSKYSGTRHVVPAQVHVNGDAALKDRETDILDD
EMPHHDLHSVDSLGTLSSSEGPQSAHLGPFTCHKSSQNSLLSDGFGSNVGEDPQGTLVPD
LGLGMDGPYERERTFGSREPKQPQPLLRKPSVSAQMQAYGQSSYSTQTWVRQQQMVVAHQ
YTFAPDGEARLVSRCPADNPGLVQAQPRVPLTPTRGTSSRVAVQRGVGSGPHPPDTQQPS
PSKAFKPRFPGDQVVNGAGPELSTGPSPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHM
NALGSQANGSVSPNSVGGGLRASSRLPDTGEGPSRATGQQGSSAEQPLGGRLRKLSLGQY
DNDAGGQLPFSKCAWGKAGVDYAPNLPPFPSPADVKETMTPGYPQDLDIIDGRILSSKES
MCSTPAFPVSPETPYVKTALRHPPFSPPEPPLSSPASQHKGGREPRGCPETLTHAVGMSE
SPIGPKSTMLRADASSTPSFQQAFASSCTISSNGPGQRRESSSSAERQWVESSPKPTVSL
PGSGRPTGSPLSAEFSGTRKDSPVLSCFPPSELQAPFHSHELSLAEPPDSLAPPSSQAFL
GFGTAPVGSGLPPEEDLGALLANSHGASPTPSIPLTATGAADNGFLAHNFLTVAPGHSSH
HSPGLQGQGVTLPGQPPLPEKKRASEGDRSLGSVSPSSSGFSSPHSGSTISIPFPNVLPD
FSKASEAASPLPDSPGDKLVIVKFVQDTSKFWYKADISREQAIAMLKDKEPGSFIVRDSH
SFRGAYGLAMKVATPPPSVLQLNKKAGDLANELVRHFLIECTPKGVRLKGCSNEPYFGSL
TALVCQHSITPLALPCKLLIPERDPLEEIAESSPQTAANSAAELLKQGAACNVWYLNSVE
MESLTGHQAIQKALSITLVQEPPPVSTVVHFKVSAQGITLTDNQRKLFFRRHYPVNSVIF
CALDPQDRKWIKDGPSSKVFGFVARKQGSATDNVCHLFAEHDPEQPASAIVNFVSKVMIG
SPKKV
Download sequence
Identical sequences G3QLN8
ENSGGOP00000003397 XP_018886959.1.27298 XP_018886960.1.27298 ENSGGOP00000003397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]