SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Gorilla gorilla 69_3.1 > ENSGGOP00000003401

Domain assignment for ENSGGOP00000003401 from Gorilla gorilla 69_3.1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSGGOP00000003401
Domain Number 1 Region: 525-594
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.64e-19
Family Complement control module/SCR domain 0.00026
Further Details:      
 
Domain Number 2 Region: 274-343
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.36e-16
Family Complement control module/SCR domain 0.0005
Further Details:      
 
Domain Number 3 Region: 776-838
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.34e-16
Family Complement control module/SCR domain 0.00053
Further Details:      
 
Domain Number 4 Region: 409-472
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.48e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 349-419
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.73e-16
Family Complement control module/SCR domain 0.00073
Further Details:      
 
Domain Number 6 Region: 910-974
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000011
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 7 Region: 153-224
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 8 Region: 661-723
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000005
Family Complement control module/SCR domain 0.00059
Further Details:      
 
Domain Number 9 Region: 600-670
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.00041
Further Details:      
 
Domain Number 10 Region: 21-83
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000089
Family Complement control module/SCR domain 0.0000169
Further Details:      
 
Domain Number 11 Region: 88-149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000625
Family Complement control module/SCR domain 0.0000167
Further Details:      
 
Domain Number 12 Region: 964-1028
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000653
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 13 Region: 845-904
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000403
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 14 Region: 214-285
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000973
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 15 Region: 740-787
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000361
Family Complement control module/SCR domain 0.0044
Further Details:      
 
Domain Number 16 Region: 490-536
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000264
Family Complement control module/SCR domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003401   Gene: ENSGGOG00000003455   Transcript: ENSGGOT00000003478
Sequence length 1092
Comment pep:novel chromosome:gorGor3.1:1:187457347:187493043:1 gene:ENSGGOG00000003455 transcript:ENSGGOT00000003478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
MGAAGLLGVFLALVAPGVLGISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGE
KSLLCITKDEVDGTWDKPAPKCEYFNKYASCPEPIVPGGYKIRGSTPYRHGDSVTFACKT
NFSMNGNKSVWCQANNMWGPTRLPTCESVFPLECPALPMIHNGHHTSENVGSIAPGLSVT
YSCESGYLLVGEKIINCLSSGKWSAVPPTCEEAHCKSLGRFPNGKVKEPPILRVGVTANF
FCDEGYRLQGPPSSRCVIAGQGVAWTKMPVCEEIFCPSPPPILNGRHIGNSLANVSYGSI
VTYTCDPDPEEGVNFILIGESTLRCTVDSQKTGTWSGPAPRCELSTSAVQCPHPQILRGR
MVSGQKDRYTYNDTVIFACMFGFTLKGSKQIRCNAQGTWEPSAPVCEKECQAPPNILNGQ
KEDRHMVRFDPGTSIKYSCNPGYVLVGEESIQCTSEGVWTPPVPHCKVAACEATGRQLLT
KPQHQFVRPDVNSSCDEGYKLSGSVYQECQGTIPWFMEIRLCKEITCPPPPVIYNGAHTG
SSLEDFPYGTTVTYTCNPGPESGVEFSLIGETTIRCTSNDQERGTWSGPAPLCKLSLLAV
QCSHVHIANGYKTSGKEAPYFYNDTVTFKCYSGFTLKGSSQIRCKADNTWDPEIPVCEKG
CQPPPGLHHGRHTGGNTVFFVSGMTVDYTCDPGYLLAGNKSIHCMPSGNWSPSAPRCEET
CQPVRQRLQELPAGSRVELVNTSCQDGYQLTGHDYQMCQDAENGIWFKKIPLCKVIHCHP
PPVIVNGKHTGMMAENFLYGNEVSYECDQGFYLLGEKKLRCRSDSKGHGSWSGPSPQCLQ
SPPVTRCSNPEVKHGYKLNKTHSAYSHNDIVYVDCNPGFIMNGSRVIRCHTDNTWVPGVP
TCIKKAFIGCQPPPKTPNGNHTGGNIARFSPGMSILYSCDQGYLLVGEALLLCTHEGTWS
QPAPHCKEVNCSSPADMDGIQKGLEPRKMYQYGAVVTLECEDGYMLEGSPQSQCQSDNEW
NPPLAVCRSRSLAPVLCGIAAGLILLTFLIVVTLYMISKHRERNYYTNTSQKEAFHLETR
EVYSVDPYNPAS
Download sequence
Identical sequences G3QLP1
ENSGGOP00000003401 XP_004028362.1.27298 ENSGGOP00000003401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.