SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003403 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003403
Domain Number 1 Region: 326-403
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 8.37e-24
Family Intermediate filament protein, coiled coil region 0.0004
Further Details:      
 
Domain Number 2 Region: 94-128
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000178
Family Intermediate filament protein, coiled coil region 0.0014
Further Details:      
 
Domain Number 3 Region: 138-201
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000204
Family Intermediate filament protein, coiled coil region 0.0083
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003403
Domain Number - Region: 216-326
Classification Level Classification E-value
Superfamily Prefoldin 0.000288
Family Prefoldin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003403   Gene: ENSGGOG00000011442   Transcript: ENSGGOT00000003480
Sequence length 548
Comment pep:novel chromosome:gorGor3.1:12:50789641:50797840:-1 gene:ENSGGOG00000011442 transcript:ENSGGOT00000003480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRQVCKKSFSGRSQGFSGRSAVVSGSSRMSCVARSGGGFGGPGVFGGPGSFGGPGGFGP
GGFPGGIQEVIVNQSLLQPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDKVRFLEQQN
KVLATKWELLQQQTTGSGPSSLEPCFESYISFLRKQLDSLLGERGNLEGELKSMQDLVED
FRKKYEDEINKRTAAENEFVGLKKDVDAAFMSKVELQAKVDSLTDEVSFLRTLYEMELSQ
MQSHVSDTSVVLSMDNNRCLDLDSIIAEVRAQYEEIAQRSKAEAEALYQTKLGELQTTAG
RHGDDLRNTKSEIMELNKMIQRLRAEIENVKKQNANLQTAIAEAEQRGEMALKDANAKLQ
DLQAALQKAKDDLARLLRDYQELMNVKLALDVEIATYRKLLEGEECRMSGECQSAVCISV
VSNVTSTRGSSGSSRGVFGGVSGSGSGGYKGGSSSSSGYGVSGGSGSGYGGVSSGSTGGR
GSSGSYQSSSSGSRLGGAGGISVSHSGMGSSSGSIQTSGGSGYKSGGGGSPSIRFSQTMS
SSQHSSTK
Download sequence
Identical sequences ENSGGOP00000011157 ENSGGOP00000003403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]