SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003404 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003404
Domain Number 1 Region: 334-495
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 4.71e-47
Family Lamin A/C globular tail domain 0.00000959
Further Details:      
 
Domain Number 2 Region: 234-310
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.08e-18
Family Intermediate filament protein, coiled coil region 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003404
Domain Number - Region: 42-142
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000706
Family Myosin rod fragments 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003404   Gene: ENSGGOG00000003462   Transcript: ENSGGOT00000003481
Sequence length 533
Comment pep:novel chromosome:gorGor3.1:19:2455669:2479209:-1 gene:ENSGGOG00000003462 transcript:ENSGGOT00000003481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVSGIKALYESELADARRVLDETARERARLQIEIGKLRAELDEVNKSAKKREGELTVAQG
RVKDLESLFHRSEVELAAALSDKRGLESDVAELRAQLAKAEDGHAVAKKQLEKETLMRVD
LENRCQSLQEELDFRKSVFEEEVRETRRRHERRLVEVDSSRQQEYDFKMAQALEELRSQH
DEQVRLYKLELEQTYQAKLDSAKLSSDQNDKAASAAREELKEARMRLESLSYQLSGLQKQ
ASAAEDRIRELEEAMAGERDKFRKMLDAKEQEMTEMRDVMQQQLAEYQELLDVKLALDME
INAYRKLLEGEEERLKLSPSPSSRVTVSRATSSSSGSMSATGRLGRSKRKRLEVEEPLGS
GPSVLGTGTGGSGGFHLAQQASASGSVSIEEIDLEGKFVQLKNNSDKDQSLGNWRIKRQV
LEGEEIAYKFTPKYILRAGQMVTVWAAGAGVAHSPPSTLVWKGQSSWGTGESFRTVLVNA
DGEEVAMRTVKKSSVMRENENGEEEEEEAEFGEEDLFHQQGDPRTTSRGCYVM
Download sequence
Identical sequences ENSGGOP00000003404 ENSGGOP00000003404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]