SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003408 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003408
Domain Number 1 Region: 409-486
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.66e-22
Family Intermediate filament protein, coiled coil region 0.00044
Further Details:      
 
Domain Number 2 Region: 176-211
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000497
Family Intermediate filament protein, coiled coil region 0.0014
Further Details:      
 
Domain Number 3 Region: 221-291
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000173
Family Intermediate filament protein, coiled coil region 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003408
Domain Number - Region: 299-406
Classification Level Classification E-value
Superfamily Prefoldin 0.0105
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003408   Gene: ENSGGOG00000003467   Transcript: ENSGGOT00000003485
Sequence length 642
Comment pep:novel chromosome:gorGor3.1:12:50668317:50673982:-1 gene:ENSGGOG00000003467 transcript:ENSGGOT00000003485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQFSSRSGYRSGGGFSSGSAGIINYQRRTTSSSTRRSGGGGGRFSSCGGGGGSFGAGG
GFGSRSLVNLGGSKSISISVARGGGRGSGFGGGYGGGGFGGGGFGGFGGGGIGGGGFGGF
GSGGGGFGGGGFGGGGYGGGYGPVCPPGGIQEVTINQSLLQPLNVEIDPEIQKVKSRERE
QIKSLNNQFASFIDKVRFLEQQNQVLQTKWELLQQVDTSTRTHNLEPYFESFINNLRRRV
DQLKSDQSRLDSELKNMQDMVEDYRNKYEDEINKRTNAENEFVTIKKDVDGAYMTKVDLQ
AKLDNLQQEIDFLTALYQAELSQMQTQISETNVILSMDNNRSLDLDSIIAEVKAQYEDIA
QKSKAEAESLYQSKYEELQITAGRHGDSVRNSKIEISELNRVIQRLRSEIDNVKKQISNL
QQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIATY
RTLLEGEESRMSGECAPNVSVSVSTSHTTISGGGGRGGGGGGYGSGGSSYGSGGGSYGSG
GGGGGGRGSYGSGGSSYGSGGGSYGSGGGGGGHGSYGSGSSSGGYRGGSGGGGGGSSGGR
GSGGGSSGGSIGGRGSSSGGVKSSGGSSSVKFVSTTYSGVTR
Download sequence
Identical sequences ENSGGOP00000003408 ENSGGOP00000003408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]