SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003413 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003413
Domain Number 1 Region: 400-477
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.22e-18
Family Intermediate filament protein, coiled coil region 0.00061
Further Details:      
 
Domain Number 2 Region: 168-202
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000012
Family Intermediate filament protein, coiled coil region 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003413
Domain Number - Region: 213-278
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000382
Family Intermediate filament protein, coiled coil region 0.011
Further Details:      
 
Domain Number - Region: 308-401
Classification Level Classification E-value
Superfamily Prefoldin 0.00288
Family Prefoldin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003413   Gene: ENSGGOG00000003471   Transcript: ENSGGOT00000003490
Sequence length 584
Comment pep:novel chromosome:gorGor3.1:12:50711289:50723538:-1 gene:ENSGGOG00000003471 transcript:ENSGGOT00000003490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHQFSSQSAFSSMSRRVYSTSSSAGSGGGSRAVGSVCYARGRRGSGGYGIHGRGFGSRS
LYNLGGSRSISINLMGRSTSGFCQGGGVGGFGGGRGFGVGSTGAGGFGGGGFGGGGFGGA
GFGTSNFGLGGFGPYCPPGGIQEVTINQSLLEPLHLEVDPEIQRIKTQEREQIMVLNNKF
ASFIDKVRFLEQQNQVLQTKWELLQQVNTSTGTNNLEPLLENYIGDLRRQVDLLNAEQMR
QNTEVRSMQDVVEDYKSKYEDEINKRTGSENDFVVLKKDVDAAYVSKVDLESRVDTLTGE
VNFLKYLFLTELSQMQTHISDTNVILSMDNNRSLDLDSIIDAVRTQYELIAQRSKDEAEA
LYQTKYQELQITAGRHGDDLKNSKMEIAELNRTVQRLQAEISNVKKQIEQMQSLISDAEE
RGEQALQDAWQKLQELEEALQQSKEELARLLRDYQAMLGVKLSLDVEIATYRQLLEGEES
RMSGELQSHVSISVQNSQVSVSGGAGGGGSYGSGGYGGGSGGGYGGGRSYRGGGARGGSG
GGYGSGGGGGGGGSYGGSGRSGRGSSRVQIIQTSTNTSHRRILE
Download sequence
Identical sequences G3SAV9
ENSGGOP00000025233 ENSGGOP00000003413 XP_004053226.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]