SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003423 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003423
Domain Number 1 Region: 34-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.1e-18
Family Complement control module/SCR domain 0.0000214
Further Details:      
 
Domain Number 2 Region: 167-229
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.7e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 3 Region: 289-358
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.73e-16
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 4 Region: 109-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000175
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 232-300
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000498
Family Complement control module/SCR domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003423   Gene: ENSGGOG00000003466   Transcript: ENSGGOT00000003500
Sequence length 385
Comment pep:novel chromosome:gorGor3.1:1:187657264:187737324:1 gene:ENSGGOG00000003466 transcript:ENSGGOT00000003500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPVRLERPFPSRRFPGLLLAALVLLLSSFSGITCGLPPTIANGYFTSISREYFHYGSV
VTYRCNPGSGGRKVFELVGEPSIYCTSKDDQVGIWSGPAPQCIIPNKCTPPNVENGILVS
DNRSLFSLNEAVEFRCQPGFVMKGHPRVHCQALNKWEPELPSCSRVCQPPPDVLHGERTQ
RDKDNFSPGEEVYYSCEPGYDLRGSTYLHCTPQGDWSPEAPRCEVKSCDDFLGQLPNGRV
LFPLNLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSSVPVCEQIFCPNPPAILNG
RHTGTLLGDIPYGKEVSYTCDPHPDRGMTFNLIGESTIRCTSDPHGNGVWSSPAPRCELP
VGAGSHDALIVGKFYEVFAEEFWHL
Download sequence
Identical sequences ENSGGOP00000003423 ENSGGOP00000003423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]